StarFunc result for job id Q9H7H0

User Input

>input (456 residues)
MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPH
VRLPQALANGAQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLEN
PDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRAR
NPAFQPQTLMDFGSGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEP
YIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLVLVENGTK
AGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSW
NKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRH
GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z5L8	0.930	0.930	1.112E-92	456	1.000	1.000	A0A0S2Z5L8.pdb.gz	A0A0S2Z5L8_HUMAN Methyltransferase like 17 isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=2 SV=1
2	AFDB:Q3U2U7	0.930	0.921	1.326E-80	461	0.798	0.790	Q3U2U7.pdb.gz	MET17_MOUSE Methyltransferase-like protein 17, mitochondrial OS=Mus musculus OX=10090 GN=Mettl17 PE=1 SV=2
3	AFDB:Q9UTM2	0.575	0.358	1.450E-25	753	0.208	0.126	Q9UTM2.pdb.gz	CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1101 PE=1 SV=2
4	AFDB:P36056	0.618	0.459	4.520E-20	628	0.206	0.150	P36056.pdb.gz	RT22_YEAST Probable S-adenosyl-L-methionine-dependent RNA methyltransferase RSM22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM22 PE=1 SV=1
5	AFDB:Q385R2	0.535	0.246	3.186E-18	1041	0.193	0.085	Q385R2.pdb.gz	Q385R2_TRYB2 Methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2710 PE=1 SV=1
6	PDB:6sgbF1	0.632	0.336	4.962E-18	889	0.211	0.108	6sgbF1.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
7	AFDB:Q6DN05	0.312	0.224	1.779E-8	666	0.092	0.063	Q6DN05.pdb.gz	Q6DN05_CHLRE Betaine lipid synthase OS=Chlamydomonas reinhardtii OX=3055 GN=BTA1 PE=2 SV=1
8	AFDB:P27680	0.259	0.362	6.416E-8	312	0.088	0.128	P27680.pdb.gz	COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ3 PE=1 SV=2
9	AFDB:Q9SW18	0.265	0.369	8.587E-8	312	0.105	0.154	Q9SW18.pdb.gz	CHLM_ARATH Magnesium protoporphyrin IX methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLM PE=1 SV=1
10	AFDB:O80483	0.268	0.365	1.369E-7	320	0.110	0.156	O80483.pdb.gz	NAS3_ARATH Nicotianamine synthase 3 OS=Arabidopsis thaliana OX=3702 GN=NAS3 PE=2 SV=1
11	AFDB:Q6NN40	0.287	0.440	1.631E-7	276	0.083	0.138	Q6NN40.pdb.gz	NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Ntmt PE=1 SV=1
12	PDB:6orrC	0.287	0.446	5.743E-7	273	0.081	0.136	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
13	PDB:6h2vA	0.272	0.530	2.771E-6	210	0.064	0.138	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
14	PDB:7nacq	0.262	0.325	2.938E-6	358	0.072	0.092	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:2i62B	0.274	0.444	3.709E-6	261	0.077	0.134	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
16	PDB:1tw2B	0.293	0.369	4.964E-6	350	0.145	0.189	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
17	PDB:4oqdC	0.264	0.469	5.913E-6	241	0.086	0.162	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.
18	PDB:2frxA	0.270	0.271	6.268E-6	455	0.096	0.097	2frxA.pdb.gz
19	PDB:1qzzA	0.280	0.360	7.466E-6	340	0.134	0.179	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
20	PDB:1g6q1	0.227	0.304	7.914E-6	328	0.077	0.107	1g6q1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5L8	0.0	936	456	1.000	1.000	A0A0S2Z5L8_HUMAN Methyltransferase like 17 isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=2 SV=1
2	A0A0S2Z5V5	0.0	909	447	0.980	1.000	A0A0S2Z5V5_HUMAN Methyltransferase like 17 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=2 SV=1
3	Q3U2U7	0.0	728	461	0.785	0.777	MET17_MOUSE Methyltransferase-like protein 17, mitochondrial OS=Mus musculus OX=10090 GN=Mettl17 PE=1 SV=2
4	Q9H7H0	0.0	936	456	1.000	1.000	MET17_HUMAN Methyltransferase-like protein 17, mitochondrial OS=Homo sapiens OX=9606 GN=METTL17 PE=1 SV=1
5	G3V353	1.94e-124	360	174	0.382	1.000	G3V353_HUMAN Methyltransferase like 17 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=1 SV=1
6	G3V3X6	2.30e-98	293	140	0.307	1.000	G3V3X6_HUMAN Methyltransferase like 17 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=1 SV=1
7	H0YJW1	1.52e-82	251	123	0.268	0.992	H0YJW1_HUMAN Methyltransferase like 17 (Fragment) OS=Homo sapiens OX=9606 GN=METTL17 PE=1 SV=1
8	Q9UTM2	7.38e-19	91.7	753	0.184	0.112	CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1101 PE=1 SV=2
9	Q385R2	2.28e-15	81.3	1041	0.134	0.059	Q385R2_TRYB2 Methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2710 PE=1 SV=1
10	P36056	0.008	41.2	628	0.044	0.032	RT22_YEAST Probable S-adenosyl-L-methionine-dependent RNA methyltransferase RSM22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM22 PE=1 SV=1
11	D3UJ80	2.1	33.1	568	0.044	0.035	D3UJ80_HELM1 Urease subunit beta OS=Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) OX=679897 GN=ureB PE=1 SV=1
12	Q5TEU4	3.8	32.3	345	0.057	0.075	NDUF5_HUMAN Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5 PE=1 SV=1
13	M9PEJ7	3.9	32.3	446	0.055	0.056	M9PEJ7_DROME Target of wingless, isoform G OS=Drosophila melanogaster OX=7227 GN=tow PE=4 SV=1
14	C9JL93	4.3	31.2	158	0.064	0.184	C9JL93_HUMAN Serpin family B member 13 (Fragment) OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
15	Q91WU0	4.6	32.3	561	0.048	0.039	EST1F_MOUSE Carboxylesterase 1F OS=Mus musculus OX=10090 GN=Ces1f PE=1 SV=1
16	Q9VRZ4	4.6	32.0	441	0.055	0.057	Q9VRZ4_DROME Target of wingless, isoform F OS=Drosophila melanogaster OX=7227 GN=tow PE=4 SV=3
17	P38892	5.9	31.6	291	0.035	0.055	CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRG1 PE=1 SV=1
18	Q4KCD7	7.4	32.0	4937	0.079	0.007	Q4KCD7_PSEF5 Polyketide synthase RzxC OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=rzxC PE=3 SV=1
19	Q9JI51	8.2	30.8	224	0.050	0.103	VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus OX=10116 GN=Vti1a PE=1 SV=1
20	G3V4Z4	8.3	30.8	252	0.026	0.048	G3V4Z4_HUMAN Aldehyde dehydrogenase 6 family member A1 OS=Homo sapiens OX=9606 GN=ALDH6A1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	0.33	23.0	Methyltransferase domain
2	PF08242 Methyltransf_12	10	18.3	Methyltransferase domain
3	PF13489 Methyltransf_23	2.2	19.5	Methyltransferase domain
4	PF13649 Methyltransf_25	0.38	22.8	Methyltransferase domain
5	PF13847 Methyltransf_31	28	15.9	Methyltransferase domain
6	PF09243 Rsm22	1.3e-61	219.9	Mitochondrial small ribosomal subunit Rsm22

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000010363

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000020929	0.774	Uncharacterized protein
2	9598.ENSPTRP00000006993	0.708	Putative lipoyltransferase 2, mitochondrial
3	9598.ENSPTRP00000035473	0.698	KIAA0020
4	9598.ENSPTRP00000023802	0.684	N-6 adenine-specific DNA methyltransferase 1 (Putative)
5	9598.ENSPTRP00000050689	0.681	Uncharacterized protein
6	9598.ENSPTRP00000002422	0.673	Death associated protein 3
7	9598.ENSPTRP00000020395	0.673	Leucine-rich PPR-motif containing
8	9598.ENSPTRP00000001997	0.659	Uncharacterized protein
9	9598.ENSPTRP00000031041	0.654	Mitochondrial ribosomal protein S10
10	9598.ENSPTRP00000016009	0.645	COX11, cytochrome c oxidase copper chaperone
11	9598.ENSPTRP00000000220	0.628	Solute carrier family 25, member 33
12	9598.ENSPTRP00000036173	0.626	Nuclear cap binding protein subunit 1, 80kDa
13	9598.ENSPTRP00000004581	0.589	Coiled-coil-helix-coiled-coil-helix domain containing 1
14	9598.ENSPTRP00000023399	0.580	DEAD-box helicase 27
15	9598.ENSPTRP00000053800	0.576	Uncharacterized protein
16	9598.ENSPTRP00000027954	0.569	Phosphatidylinositol glycan anchor biosynthesis, class Y
17	9598.ENSPTRP00000034500	0.559	Dual specificity phosphatase 26 (putative)
18	9598.ENSPTRP00000061037	0.559	RNA pseudouridylate synthase domain containing 3
19	9598.ENSPTRP00000053533	0.551	Uncharacterized protein
20	9598.ENSPTRP00000024165	0.547	Cat eye syndrome chromosome region, candidate 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0003674	1.000	molecular_function
GO:1901681	0.960	sulfur compound binding
GO:0005515	0.957	protein binding
GO:1904047	0.953	S-adenosyl-L-methionine binding
GO:0043022	0.952	ribosome binding
GO:0097177	0.816	mitochondrial ribosome binding
GO:0003824	0.660	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0042254	0.974	ribosome biogenesis
GO:0042274	0.924	ribosomal small subunit biogenesis
GO:0008152	0.528	metabolic process
GO:0044237	0.524	cellular metabolic process
GO:0071704	0.506	organic substance metabolic process
GO:0044238	0.481	primary metabolic process
GO:0006807	0.451	nitrogen compound metabolic process
GO:0043170	0.425	macromolecule metabolic process
GO:0034641	0.394	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.730	cytoplasm
GO:0005739	0.588	mitochondrion
GO:0043228	0.525	non-membrane-bounded organelle
GO:0043232	0.522	intracellular non-membrane-bounded organelle
GO:0005759	0.348	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]