StarFunc result for job id Q9H7J1

User Input

>input (279 residues)
MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEPGEGGTRFGARSRAHAPSR
GRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIQL
QRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSARV
VDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLFALRY
RVTGHEFWDNNGGRDYALRGPEHPGSGGAPEPQGWIHFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7L8	0.498	0.498	4.467E-41	279	0.889	0.889	P0C7L8.pdb.gz	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
2	AFDB:D3ZZ26	0.393	0.393	6.258E-21	279	0.384	0.384	D3ZZ26.pdb.gz	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
3	AFDB:O95685	0.413	0.389	2.176E-20	299	0.369	0.344	O95685.pdb.gz	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
4	AFDB:Q9UQK1	0.403	0.358	2.689E-15	317	0.211	0.186	Q9UQK1.pdb.gz	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
5	AFDB:Q9VVY3	0.385	0.166	2.845E-15	681	0.269	0.110	Q9VVY3.pdb.gz	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
6	AFDB:Q86XI6	0.395	0.387	4.476E-15	285	0.229	0.225	Q86XI6.pdb.gz	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
7	AFDB:Q5U2R5	0.396	0.352	6.655E-15	317	0.226	0.199	Q5U2R5.pdb.gz	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
8	AFDB:Q6IN01	0.395	0.389	7.887E-15	284	0.233	0.229	Q6IN01.pdb.gz	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
9	AFDB:Q8SXW5	0.380	0.280	1.500E-13	384	0.219	0.159	Q8SXW5.pdb.gz	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
10	AFDB:T1SFR8	0.411	0.403	1.587E-13	285	0.229	0.225	T1SFR8.pdb.gz	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
11	PDB:1ea9C	0.260	0.132	1.749E-3	583	0.039	0.019	1ea9C.pdb.gz
12	PDB:1j0hA	0.269	0.134	5.746E-3	588	0.039	0.019	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
13	PDB:4edqA	0.218	0.136	1.012E-2	483	0.054	0.031	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
14	PDB:7vt9A	0.243	0.119	1.012E-2	604	0.029	0.013	7vt9A.pdb.gz
15	PDB:1l9mB	0.197	0.091	1.270E-2	681	0.054	0.022	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
16	PDB:4dsyB	0.220	0.155	2.806E-2	426	0.043	0.028	4dsyB.pdb.gz	Identification of purple acid phosphatase inhibitors by fragment-based screening: promising new leads for osteoporosis therapeutics.
17	PDB:6b2eB	0.185	0.251	6.946E-2	193	0.047	0.067	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:7qpdT	0.206	0.173	6.946E-2	348	0.054	0.043	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
19	PDB:6de7L	0.209	0.264	7.350E-2	208	0.050	0.067	6de7L.pdb.gz	Interdomain Stabilization Impairs CD4 Binding and Improves Immunogenicity of the HIV-1 Envelope Trimer.
20	PDB:2q2eB	0.117	0.064	8.712E-2	581	0.047	0.022	2q2eB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7L8	3.83e-151	425	279	0.889	0.889	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
2	D3ZZ26	9.09e-43	149	279	0.333	0.333	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
3	O95685	3.76e-42	148	299	0.358	0.334	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
4	Q6IN01	2.16e-21	93.2	284	0.208	0.204	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
5	Q86XI6	3.99e-21	92.4	285	0.204	0.200	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
6	Q8C767	4.67e-21	92.0	284	0.211	0.208	PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
7	T1SFR8	2.89e-20	90.1	285	0.186	0.182	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
8	Q9VVY3	3.92e-19	89.4	681	0.247	0.101	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
9	Q9UQK1	3.88e-18	84.7	317	0.176	0.155	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
10	Q9CW07	2.00e-17	83.2	347	0.283	0.228	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
11	Q5U2R5	1.48e-16	80.1	317	0.186	0.164	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
12	Q8SWT8	1.10e-14	75.1	330	0.194	0.164	Q8SWT8_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
13	Q9VUF3	1.56e-14	75.1	384	0.194	0.141	Q9VUF3_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=4 SV=1
14	Q99MR9	4.44e-14	74.3	1089	0.204	0.052	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
15	Q8SXW5	6.69e-14	73.2	384	0.190	0.138	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
16	Q00756	9.20e-14	73.6	1109	0.222	0.056	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
17	Q6NX94	1.39e-13	70.9	253	0.190	0.209	Q6NX94_DANRE Protein phosphatase 1 regulatory subunit OS=Danio rerio OX=7955 GN=fj66e08 PE=2 SV=1
18	Q7TMB3	2.85e-13	70.9	317	0.179	0.158	PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
19	P40036	2.34e-07	53.9	548	0.104	0.053	GIP2_YEAST GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
20	Q6ZSY5	1.21e-05	48.9	799	0.136	0.048	PPR3F_HUMAN Protein phosphatase 1 regulatory subunit 3F OS=Homo sapiens OX=9606 GN=PPP1R3F PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16760 CBM53	2.1e-06	39.6	Starch/carbohydrate-binding module (family 53)
2	PF03370 CBM_21	3.1e-17	74.1	Carbohydrate/starch-binding module (family 21)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.936	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000055335	0.917	Protein phosphatase 1 regulatory subunit 3F
3	9606.ENSP00000326031	0.913	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
4	9606.ENSP00000284601	0.852	Protein phosphatase 1 regulatory subunit 3A
5	9606.ENSP00000378769	0.850	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
6	9606.ENSP00000308318	0.849	Protein phosphatase 1 regulatory subunit 3B
7	9606.ENSP00000238994	0.839	Protein phosphatase 1 regulatory subunit 3C
8	9606.ENSP00000360035	0.823	Protein phosphatase 1 regulatory subunit 3D
9	9606.ENSP00000261195	0.749	Glycogen [starch] synthase, liver
10	9606.ENSP00000365694	0.723	Serine/threonine-protein phosphatase 1 regulatory subunit 10
11	9606.ENSP00000317904	0.689	Glycogen [starch] synthase, muscle
12	9606.ENSP00000393832	0.656	Protein phosphatase 1 regulatory subunit 3G
13	9606.ENSP00000221138	0.613	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
14	9606.ENSP00000378306	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
15	9606.ENSP00000378323	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
16	9606.ENSP00000380878	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
17	9606.ENSP00000418447	0.613	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
18	9606.ENSP00000455607	0.613	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
19	9606.ENSP00000272298	0.608	Calmodulin 2 (phosphorylase kinase, delta)
20	9606.ENSP00000304643	0.608	Calmodulin-like protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0019899	0.890	enzyme binding
GO:0050196	0.688	[phosphorylase] phosphatase activity
GO:0098772	0.430	molecular function regulator activity
GO:0030234	0.418	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0070873	0.966	regulation of glycogen metabolic process
GO:0043255	0.961	regulation of carbohydrate biosynthetic process
GO:0009894	0.930	regulation of catabolic process
GO:0010604	0.912	positive regulation of macromolecule metabolic process
GO:0010906	0.894	regulation of glucose metabolic process
GO:0062013	0.889	positive regulation of small molecule metabolic process
GO:0010962	0.877	regulation of glucan biosynthetic process
GO:0005979	0.874	regulation of glycogen biosynthetic process
GO:0043470	0.868	regulation of carbohydrate catabolic process
GO:0031329	0.787	regulation of cellular catabolic process
GO:0031328	0.783	positive regulation of cellular biosynthetic process
GO:0010676	0.773	positive regulation of cellular carbohydrate metabolic process
GO:0010907	0.759	positive regulation of glucose metabolic process
GO:0009987	0.457	cellular process
GO:0008152	0.382	metabolic process
GO:0010557	0.380	positive regulation of macromolecule biosynthetic process
GO:0071704	0.348	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0032991	0.919	protein-containing complex
GO:0042587	0.696	glycogen granule
GO:0005634	0.389	nucleus
GO:0005829	0.388	cytosol
GO:1902494	0.375	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:3.1.3.17	0.688	[phosphorylase] phosphatase.

[back to server]