StarFunc result for job id Q9H7L9

User Input

>input (328 residues)
MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKH
DEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE
TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI
MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEH
LPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR
KTSDSTKMRIYLGQLQRGLFVIRRRSAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BR65	0.632	0.632	1.631E-44	328	0.979	0.979	Q8BR65.pdb.gz	SDS3_MOUSE Sin3 histone deacetylase corepressor complex component SDS3 OS=Mus musculus OX=10090 GN=Suds3 PE=1 SV=1
2	AFDB:Q8MS11	0.360	0.361	7.742E-22	327	0.372	0.373	Q8MS11.pdb.gz	Q8MS11_DROME RE74901p OS=Drosophila melanogaster OX=7227 GN=CG14220 PE=2 SV=1
3	AFDB:Q5PSV4	0.354	0.358	2.372E-15	323	0.262	0.266	Q5PSV4.pdb.gz	BRM1L_HUMAN Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens OX=9606 GN=BRMS1L PE=1 SV=2
4	AFDB:Q9VYI2	0.291	0.356	3.537E-4	259	0.180	0.228	Q9VYI2.pdb.gz	Q9VYI2_DROME BRMS1 transcriptional repressor OS=Drosophila melanogaster OX=7227 GN=Brms1 PE=1 SV=2
5	AFDB:Q99N20	0.311	0.404	6.932E-3	246	0.155	0.207	Q99N20.pdb.gz	BRMS1_MOUSE Breast cancer metastasis-suppressor 1 homolog OS=Mus musculus OX=10090 GN=Brms1 PE=2 SV=1
6	AFDB:E9PRF4	0.121	0.037	2.226E-2	1259	0.107	0.028	E9PRF4.pdb.gz	E9PRF4_HUMAN SET domain bifurcated histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SETDB1 PE=1 SV=1
7	AFDB:Q585K6	0.248	0.190	1.358E-1	450	0.137	0.100	Q585K6.pdb.gz	Q585K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.180 PE=4 SV=1
8	PDB:1lfoA	0.101	0.223	1.777E-1	128	0.034	0.086	1lfoA.pdb.gz	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.
9	PDB:3fb9A	0.163	0.566	2.117E-1	89	0.015	0.056	3fb9A.pdb.gz
10	PDB:7w3ax	0.107	0.076	2.117E-1	494	0.037	0.024	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
11	PDB:7okyZ	0.125	0.111	2.245E-1	374	0.015	0.013	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
12	PDB:6tedZ	0.140	0.093	2.522E-1	510	0.015	0.010	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:7nkxZ	0.139	0.272	2.522E-1	156	0.018	0.038	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:5e1lA	0.134	0.237	2.674E-1	173	0.049	0.092	5e1lA.pdb.gz
15	PDB:3jb9F	0.089	0.315	2.835E-1	82	0.021	0.085	3jb9F.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:4a60A	0.120	0.241	2.835E-1	141	0.015	0.035	4a60A.pdb.gz
17	PDB:7abi7	0.123	0.169	2.835E-1	236	0.015	0.021	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
18	AFDB:P31385	0.322	0.268	4.116E-1	405	0.140	0.114	P31385.pdb.gz	DEP1_YEAST Transcriptional regulatory protein DEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DEP1 PE=1 SV=3
19	AFDB:Q388D2	0.127	0.108	4.363E-1	391	0.131	0.110	Q388D2.pdb.gz	Q388D2_TRYB2 SH3 domain protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1950 PE=4 SV=1
20	AFDB:E9QCU8	0.163	0.055	4.903E-1	1288	0.134	0.034	E9QCU8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BR65	0.0	652	328	0.979	0.979	SDS3_MOUSE Sin3 histone deacetylase corepressor complex component SDS3 OS=Mus musculus OX=10090 GN=Suds3 PE=1 SV=1
2	Q9H7L9	0.0	664	328	1.000	1.000	SDS3_HUMAN Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2
3	Q8MS11	2.14e-68	218	327	0.387	0.388	Q8MS11_DROME RE74901p OS=Drosophila melanogaster OX=7227 GN=CG14220 PE=2 SV=1
4	Q9VWG2	2.34e-68	218	327	0.387	0.388	Q9VWG2_DROME FI07430p OS=Drosophila melanogaster OX=7227 GN=SDS3 PE=2 SV=1
5	Q5PSV4	1.09e-28	114	323	0.265	0.269	BRM1L_HUMAN Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens OX=9606 GN=BRMS1L PE=1 SV=2
6	Q9VYI2	6.03e-11	63.9	259	0.183	0.232	Q9VYI2_DROME BRMS1 transcriptional repressor OS=Drosophila melanogaster OX=7227 GN=Brms1 PE=1 SV=2
7	Q99N20	7.53e-08	54.7	246	0.122	0.163	BRMS1_MOUSE Breast cancer metastasis-suppressor 1 homolog OS=Mus musculus OX=10090 GN=Brms1 PE=2 SV=1
8	Q9HCU9	4.82e-07	52.4	246	0.131	0.175	BRMS1_HUMAN Breast cancer metastasis-suppressor 1 OS=Homo sapiens OX=9606 GN=BRMS1 PE=1 SV=1
9	Q86UU1	0.024	38.9	1377	0.110	0.026	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
10	P48681	0.23	35.8	1621	0.149	0.030	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
11	A0A8I6A3T2	0.42	35.0	1792	0.104	0.019	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
12	D3ZQN7	0.42	35.0	1786	0.104	0.019	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
13	A0A8I5ZQ25	0.47	35.0	1834	0.104	0.019	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
14	Q9UTB6	0.56	33.9	267	0.104	0.127	SDS3_SCHPO Transcriptional regulatory protein sds3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds3 PE=1 SV=1
15	P40505	1.6	32.7	327	0.085	0.086	SDS3_YEAST Transcriptional regulatory protein SDS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDS3 PE=1 SV=1
16	O12369	2.2	32.3	428	0.073	0.056	O12369_9VIRU Nucleoprotein OS=Orthohantavirus negraense OX=3052489 PE=1 SV=1
17	Q8I3S3	7.1	31.2	1894	0.091	0.016	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08598 Sds3	9.5e-14	63.5	Sds3-like
2	PF18373 Spectrin_like	3.2e+02	12.9	Spectrin like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010366570.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380194.1	0.994	SIN3 transcription regulator family member A
2	61622.XP_010352359.1	0.971	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
3	61622.XP_010380663.1	0.971	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
4	61622.XP_010359776.1	0.968	SIN3 transcription regulator family member B
5	61622.XP_010359998.1	0.968	Paired amphipathic helix protein Sin3b-like
6	61622.XP_010355152.1	0.966	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
7	61622.XP_010355993.1	0.966	AT-rich interactive domain-containing protein 4A isoform X1
8	61622.XP_010364723.1	0.962	Breast cancer metastasis-suppressor 1
9	61622.XP_010382951.1	0.960	AT-rich interactive domain-containing protein 4B isoform X1
10	61622.XP_010363627.1	0.956	Breast cancer metastasis-suppressor 1-like protein
11	61622.XP_010383032.1	0.946	Inhibitor of growth protein 1 isoform X1
12	61622.XP_010367558.1	0.938	RB binding protein 7, chromatin remodeling factor
13	61622.XP_010376217.1	0.933	Inhibitor of growth family member 2
14	61622.XP_010352478.1	0.930	RB binding protein 4, chromatin remodeling factor
15	61622.XP_010376624.1	0.925	PHD finger protein 12
16	61622.XP_010384518.1	0.925	Protein FAM60A
17	61622.XP_010386548.1	0.924	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
18	61622.XP_010361732.1	0.923	Sin3A associated protein 130
19	61622.XP_010362317.1	0.902	Sin3A associated protein 30
20	61622.XP_010365082.1	0.894	EMSY, BRCA2 interacting transcriptional repressor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019213	0.998	deacetylase activity
GO:0016810	0.996	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0042826	0.996	histone deacetylase binding
GO:0042802	0.991	identical protein binding
GO:0016811	0.901	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0033558	0.831	protein lysine deacetylase activity
GO:0004407	0.812	histone deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0043170	0.987	macromolecule metabolic process
GO:0044238	0.986	primary metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0048523	0.978	negative regulation of cellular process
GO:0043412	0.977	macromolecule modification
GO:0036211	0.963	protein modification process
GO:0010468	0.957	regulation of gene expression
GO:0098732	0.943	macromolecule deacylation
GO:1902679	0.941	negative regulation of RNA biosynthetic process
GO:0006357	0.937	regulation of transcription by RNA polymerase II
GO:0016570	0.931	histone modification
GO:0000122	0.922	negative regulation of transcription by RNA polymerase II
GO:0032501	0.918	multicellular organismal process
GO:0032502	0.915	developmental process
GO:0048856	0.908	anatomical structure development
GO:0007275	0.827	multicellular organism development
GO:0048518	0.796	positive regulation of biological process
GO:0009987	0.752	cellular process
GO:0048522	0.700	positive regulation of cellular process
GO:0030901	0.694	midbrain development
GO:0006476	0.689	protein deacetylation
GO:0016575	0.594	histone deacetylation
GO:0048857	0.513	neural nucleus development
GO:0010941	0.414	regulation of cell death
GO:0043067	0.315	regulation of programmed cell death
GO:0042981	0.310	regulation of apoptotic process
GO:0010604	0.307	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.994	cytosol
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0000785	0.941	chromatin
GO:0140513	0.941	nuclear protein-containing complex
GO:1902494	0.938	catalytic complex
GO:0000118	0.930	histone deacetylase complex
GO:0070822	0.705	Sin3-type complex
GO:0016604	0.562	nuclear body
GO:0016580	0.382	Sin3 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.-.-	0.996	Acting on carbon-nitrogen bonds, other than peptide bonds.
EC:3.5.1.-	0.901	In linear amides.
RHEA:58108	0.831	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
RHEA:58196	0.812	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.812	histone deacetylase.

[back to server]