StarFunc result for job id Q9H7M6

User Input

>input (989 residues)
MEPPAAKRSRGCPAGPEERDAGAGAARGRGRPEALLDLSAKRVAESWAFEQVEERFSRVP
EPVQKRIVFWSFPRSEREICMYSSLGYPPPEGEHDARVPFTRGLHLLQSGAVDRVLQVGF
HLSGNIREPGSPGEPERLYHVSISFDRCKITSVSCGCDNRDLFYCAHVVALSLYRIRHAH
QVELRLPISETLSQMNRDQLQKFVQYLISAHHTEVLPTAQRLADEILLLGSEINLVNGAP
DPTAGAGIEDANCWHLDEEQIQEQVKQLLSNGGYYGASQQLRSMFSKVREMLRMRDSNGA
RMLILMTEQFLQDTRLALWRQQGAGMTDKCRQLWDELGALWVCVVLSPHCKPEERAGWLQ
LLSRWDKLDVCPLEEGNYSFDGPSLQPTMAPAPELLQKGSTCITNTEGWVGHPLDPIGCL
CRALLEACRLEEETLTLYPDSGPEKRKVAYQHVPVPGSPGESYLVLALEVALLGLGQQRA
LPEGLYAQDKVVRNEEQLLALLEEVELDERLVQVLRKQAGLLLEGGPFSGFGEVLFRESV
PMHTCARYLFTALLPHDPDLAYRLALRAMRLPILETAFPAGEPHPSPLDSIMSNRFPRWF
ILGHLETRQCELASTMLTAAKGDPKWLHTVLGSIQQNIHSPALLFKLAQDACKTATPVSA
PPDTTLLGIALELGLQVMRMTLNVMTWRRREMVRWLVSCATEIGPQALMNIMQNWYSLFT
PVEAATIVAVTGTTHATLLRLQLDTSRREELWACARTLALQCAMKDPQNCALPALTLCEK
NHSAFEAAYQIVLDAAAGGLGHAHLFTVARYMEHRGLPLRAYKLATLALAQLSIAFNQDS
HPAVNDVLWACSLSHSLGRHELSAIVPLIIRSIHCAPMLSDILRRWTLSAPGLGPLGARR
AAKPLGADRAPLCQLLDAAVTAYITTSHSRLTHISPRHYGDFIEFLGKARETFLLAPDGH
LQFSQFLENLKQTYKGKKKLMLLVRERFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C7B8	0.824	0.748	0.000	1101	0.927	0.833	Q8C7B8.pdb.gz	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
2	AFDB:Q9P217	0.822	0.698	3.766E-94	1185	0.685	0.571	Q9P217.pdb.gz	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
3	AFDB:Q80TB7	0.786	0.658	2.868E-90	1207	0.646	0.529	Q80TB7.pdb.gz	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
4	AFDB:A7E2V4	0.499	0.299	1.683E-28	1837	0.316	0.170	A7E2V4.pdb.gz	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
5	AFDB:Q21875	0.524	0.332	2.063E-25	1717	0.237	0.136	Q21875.pdb.gz	Q21875_CAEEL SWIM-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebax-1 PE=1 SV=2
6	AFDB:Q9VWN9	0.584	0.308	4.620E-24	2103	0.297	0.140	Q9VWN9.pdb.gz	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
7	AFDB:Q13099	0.162	0.185	3.444E-6	824	0.070	0.084	Q13099.pdb.gz	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
8	AFDB:Q61371	0.154	0.176	3.722E-6	824	0.077	0.092	Q61371.pdb.gz	IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus OX=10090 GN=Ift88 PE=1 SV=2
9	AFDB:Q5N829	0.126	0.129	6.169E-6	953	0.089	0.092	Q5N829.pdb.gz	ZIP4L_ORYSJ TPR repeat-containing protein ZIP4 OS=Oryza sativa subsp. japonica OX=39947 GN=ZIP4 PE=1 SV=1
10	AFDB:G5ED37	0.182	0.208	9.098E-6	820	0.086	0.104	G5ED37.pdb.gz	G5ED37_CAEEL Intraflagellar transport protein 88 homolog OS=Caenorhabditis elegans OX=6239 GN=osm-5 PE=2 SV=1
11	PDB:4c0qA	0.161	0.175	2.743E-5	871	0.106	0.121	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
12	PDB:6gx9A	0.146	0.153	6.970E-5	912	0.100	0.109	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
13	PDB:4bujB	0.104	0.085	9.512E-5	1367	0.078	0.056	4bujB.pdb.gz
14	PDB:7dkhI	0.141	0.148	1.516E-4	914	0.098	0.106	7dkhI.pdb.gz
15	PDB:7mqaLM	0.140	0.087	2.513E-4	2041	0.125	0.061	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6tedQ	0.115	0.123	3.565E-4	890	0.092	0.102	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:6bq1B	0.147	0.183	3.706E-4	728	0.095	0.129	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
18	PDB:3s4wB	0.108	0.099	3.853E-4	1146	0.107	0.092	3s4wB.pdb.gz
19	PDB:6fvbA	0.142	0.142	4.501E-4	1001	0.084	0.083	6fvbA.pdb.gz
20	PDB:7mq8LP	0.180	0.279	4.865E-4	567	0.067	0.116	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TB7	0.0	793	1207	0.383	0.314	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
2	Q8C7B8	0.0	1087	1101	0.567	0.510	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
3	Q9P217	0.0	827	1185	0.417	0.348	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
4	Q3UHH1	1.57e-58	222	1832	0.155	0.084	ZSWM8_MOUSE Zinc finger SWIM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zswim8 PE=1 SV=1
5	A7E2V4	1.91e-58	222	1837	0.155	0.083	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
6	Q9VWN9	3.14e-54	209	2103	0.134	0.063	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
7	Q21875	1.27e-30	133	1717	0.111	0.064	Q21875_CAEEL SWIM-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebax-1 PE=1 SV=2
8	Q8CDJ3	0.90	35.8	492	0.029	0.059	BAKOR_MOUSE Beclin 1-associated autophagy-related key regulator OS=Mus musculus OX=10090 GN=Atg14 PE=1 SV=1
9	Q13241	1.9	33.5	179	0.015	0.084	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
10	O70458	3.8	33.9	971	0.015	0.015	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
11	P39720	5.0	33.5	1047	0.030	0.029	OAF1_YEAST Oleate-activated transcription factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OAF1 PE=1 SV=3
12	O22940	5.4	33.1	370	0.029	0.078	TEEBE_ARATH Protein TEEBE OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
13	O14157	6.8	33.1	2104	0.025	0.012	MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo3 PE=1 SV=1
14	Q8S9K8	7.0	32.3	275	0.036	0.131	MES10_ARATH Methylesterase 10 OS=Arabidopsis thaliana OX=3702 GN=MES10 PE=1 SV=1
15	Q9VU41	8.3	32.7	451	0.025	0.055	ZMY10_DROME Zinc finger MYND domain-containing protein 10 homolog OS=Drosophila melanogaster OX=7227 GN=Zmynd10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04434 SWIM	8.1e+02	11.1	SWIM zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262306	0.685	Elongin-B
2	9606.ENSP00000381693	0.676	Zinc finger SWIM-type containing 8
3	9606.ENSP00000444856	0.651	Cullin-2
4	9606.ENSP00000477310	0.642	Dynein light chain 2, cytoplasmic
5	9606.ENSP00000418875	0.635	Probable threonine protease PRSS50
6	9606.ENSP00000256367	0.624	Tetratricopeptide repeat domain containing
7	9606.ENSP00000449137	0.608	UPF0575 protein C19orf67
8	9606.ENSP00000298295	0.572	Protein DEPP1
9	9606.ENSP00000291900	0.566	Protein zer-1 homolog
10	9606.ENSP00000299320	0.553	Uncharacterized protein C16orf71
11	9606.ENSP00000216225	0.551	E3 ubiquitin-protein ligase RBX1
12	9606.ENSP00000294353	0.550	Protein zyg-11 homolog B
13	9606.ENSP00000360583	0.550	Protein zyg-11 homolog A
14	9606.ENSP00000252744	0.545	Zinc finger SWIM-type containing 6
15	9606.ENSP00000352614	0.545	Zinc finger SWIM-type containing 5
16	9606.ENSP00000308236	0.540	COMM domain-containing protein 1
17	9606.ENSP00000321388	0.540	Ankyrin repeat and SOCS box protein 4
18	9606.ENSP00000359385	0.540	Glomulin
19	9606.ENSP00000297632	0.529	Transmembrane protein 65

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.590	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050789	0.963	regulation of biological process
GO:0050794	0.934	regulation of cellular process
GO:0032501	0.656	multicellular organismal process
GO:0048856	0.625	anatomical structure development
GO:0007275	0.550	multicellular organism development
GO:0071840	0.542	cellular component organization or biogenesis
GO:0016043	0.497	cellular component organization
GO:0008152	0.489	metabolic process
GO:0071704	0.469	organic substance metabolic process
GO:0048731	0.451	system development
GO:0030154	0.415	cell differentiation
GO:0019222	0.389	regulation of metabolic process
GO:0120036	0.377	plasma membrane bounded cell projection organization
GO:0007399	0.376	nervous system development
GO:0043170	0.360	macromolecule metabolic process
GO:0009653	0.360	anatomical structure morphogenesis
GO:0022008	0.358	neurogenesis
GO:0000902	0.350	cell morphogenesis
GO:0048666	0.348	neuron development
GO:0060322	0.339	head development
GO:0032989	0.333	cellular component morphogenesis
GO:0007417	0.329	central nervous system development
GO:0048513	0.328	animal organ development
GO:0044238	0.316	primary metabolic process
GO:0031175	0.314	neuron projection development
GO:0040012	0.312	regulation of locomotion
GO:0007420	0.310	brain development
GO:0006807	0.306	nitrogen compound metabolic process
GO:0120039	0.304	plasma membrane bounded cell projection morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0032991	0.954	protein-containing complex
GO:0005622	0.809	intracellular anatomical structure
GO:0005576	0.750	extracellular region
GO:0043227	0.705	membrane-bounded organelle
GO:0005615	0.594	extracellular space
GO:0005737	0.592	cytoplasm
GO:0043229	0.448	intracellular organelle
GO:0043231	0.376	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]