StarFunc result for job id Q9H7M9

User Input

>input (311 residues)
MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPV
DKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
SASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVV
YPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGI
ENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLD
PVPDSPNFEVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H7M9	1.000	1.000	2.573E-54	311	1.000	1.000	Q9H7M9.pdb.gz	VISTA_HUMAN V-type immunoglobulin domain-containing suppressor of T-cell activation OS=Homo sapiens OX=9606 GN=VSIR PE=1 SV=3
2	AFDB:Q9D659	0.643	0.648	6.298E-40	308	0.768	0.776	Q9D659.pdb.gz	VISTA_MOUSE V-type immunoglobulin domain-containing suppressor of T-cell activation OS=Mus musculus OX=10090 GN=Vsir PE=1 SV=2
3	AFDB:Q8IW00	0.342	0.333	5.837E-11	320	0.186	0.181	Q8IW00.pdb.gz	VSTM4_HUMAN V-set and transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSTM4 PE=1 SV=3
4	AFDB:T1NXB5	0.360	0.351	6.874E-11	319	0.186	0.182	T1NXB5.pdb.gz	VSTM4_MOUSE V-set and transmembrane domain-containing protein 4 OS=Mus musculus OX=10090 GN=Vstm4 PE=1 SV=1
5	AFDB:B0CLV1	0.293	0.224	2.952E-9	428	0.151	0.110	B0CLV1.pdb.gz	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
6	AFDB:D3ZIN8	0.287	0.306	3.292E-9	287	0.180	0.195	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
7	AFDB:Q9D2J4	0.345	0.272	5.376E-9	407	0.183	0.140	Q9D2J4.pdb.gz	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
8	AFDB:Q86XK7	0.309	0.254	9.271E-9	387	0.196	0.158	Q86XK7.pdb.gz	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
9	AFDB:A0A2R8RYG1	0.154	0.114	1.988E-8	442	0.190	0.133	A0A2R8RYG1.pdb.gz
10	AFDB:Q8WVN6	0.246	0.301	2.341E-8	248	0.141	0.177	Q8WVN6.pdb.gz	SCTM1_HUMAN Secreted and transmembrane protein 1 OS=Homo sapiens OX=9606 GN=SECTM1 PE=1 SV=2
11	PDB:5ir3A	0.262	0.644	1.301E-6	111	0.080	0.225	5ir3A.pdb.gz
12	PDB:3oaiA	0.284	0.190	5.367E-6	488	0.077	0.049	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
13	PDB:2cd0A	0.291	0.741	7.048E-6	111	0.084	0.234	2cd0A.pdb.gz
14	PDB:6hd8A	0.285	0.201	2.468E-5	461	0.074	0.050	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
15	PDB:7czpH	0.279	0.374	2.752E-5	222	0.064	0.090	7czpH.pdb.gz
16	PDB:1fdlL	0.284	0.398	3.069E-5	214	0.080	0.117	1fdlL.pdb.gz
17	PDB:1cd0A	0.273	0.687	5.589E-5	111	0.080	0.225	1cd0A.pdb.gz
18	PDB:2qhrL	0.272	0.371	7.340E-5	218	0.077	0.110	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
19	PDB:4aizA	0.236	0.610	9.639E-5	107	0.064	0.187	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
20	PDB:1aifA	0.255	0.340	1.135E-4	215	0.061	0.088	1aifA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7M9	0.0	643	311	1.000	1.000	VISTA_HUMAN V-type immunoglobulin domain-containing suppressor of T-cell activation OS=Homo sapiens OX=9606 GN=VSIR PE=1 SV=3
2	Q9D659	9.72e-167	467	308	0.772	0.779	VISTA_MOUSE V-type immunoglobulin domain-containing suppressor of T-cell activation OS=Mus musculus OX=10090 GN=Vsir PE=1 SV=2
3	D4AE25	1.43e-05	48.1	290	0.113	0.121	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
4	Q4QTK1	5.28e-05	46.6	287	0.103	0.111	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
5	Q9EP73	1.95e-04	44.7	290	0.106	0.114	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
6	Q9NZQ7	5.51e-04	43.1	290	0.106	0.114	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
7	Q5QNS5	0.005	40.4	305	0.100	0.102	HAVR1_MOUSE Hepatitis A virus cellular receptor 1 homolog OS=Mus musculus OX=10090 GN=Havcr1 PE=1 SV=2
8	Q56A07	0.007	39.3	215	0.177	0.256	SCN2B_MOUSE Sodium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Scn2b PE=1 SV=1
9	Q86XK7	0.019	38.9	387	0.103	0.083	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
10	P0C0K5	0.038	37.7	282	0.048	0.053	HAVR2_RAT Hepatitis A virus cellular receptor 2 homolog OS=Rattus norvegicus OX=10116 GN=Havcr2 PE=2 SV=2
11	P54900	0.058	36.6	215	0.170	0.247	SCN2B_RAT Sodium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Scn2b PE=1 SV=1
12	O60939	0.16	35.4	215	0.161	0.233	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
13	O54947	0.18	35.4	307	0.100	0.101	HAVR1_RAT Hepatitis A virus cellular receptor 1 homolog OS=Rattus norvegicus OX=10116 GN=Havcr1 PE=2 SV=1
14	Q5SQ64	0.28	35.0	297	0.074	0.077	LY66F_HUMAN Lymphocyte antigen 6 complex locus protein G6f OS=Homo sapiens OX=9606 GN=LY6G6F PE=1 SV=2
15	Q8TDQ0	0.47	34.3	301	0.039	0.040	HAVR2_HUMAN Hepatitis A virus cellular receptor 2 OS=Homo sapiens OX=9606 GN=HAVCR2 PE=1 SV=3
16	P13596	0.52	34.7	858	0.103	0.037	NCAM1_RAT Neural cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ncam1 PE=1 SV=1
17	Q9BRK3	0.68	33.9	442	0.109	0.077	MXRA8_HUMAN Matrix remodeling-associated protein 8 OS=Homo sapiens OX=9606 GN=MXRA8 PE=1 SV=1
18	O70355	2.6	32.0	454	0.141	0.097	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
19	Q8IWT1	2.6	31.6	228	0.051	0.070	SCN4B_HUMAN Sodium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=SCN4B PE=1 SV=1
20	Q9UM44	2.7	32.0	414	0.061	0.046	HHLA2_HUMAN HERV-H LTR-associating protein 2 OS=Homo sapiens OX=9606 GN=HHLA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	0.0013	30.2	Immunoglobulin domain
2	PF13895 Ig_2	3.9	19.2	Immunoglobulin domain
3	PF13927 Ig_3	0.38	22.6	Immunoglobulin domain
4	PF06328 Lep_receptor_Ig	2.6e+02	13.0	Ig-like C2-type domain
5	PF07686 V-set	3.3e-06	38.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378409

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377370	0.872	Immunoglobulin superfamily member 11
2	9606.ENSP00000316809	0.626	Phosphatidylinositol transfer protein alpha isoform
3	9606.ENSP00000329357	0.564	Transcription factor Sp1
4	9606.ENSP00000203629	0.556	Lymphocyte activation gene 3 protein
5	9606.ENSP00000333919	0.556	B- and T-lymphocyte attenuator
6	9606.ENSP00000312002	0.537	Hepatitis A virus cellular receptor 2
7	9606.ENSP00000419085	0.528	T-cell immunoreceptor with Ig and ITIM domains
8	9606.ENSP00000370989	0.509	Programmed cell death 1 ligand 1
9	9606.ENSP00000335062	0.503	Programmed cell death protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.952	molecular function regulator activity
GO:0019899	0.852	enzyme binding
GO:0061134	0.832	peptidase regulator activity
GO:0016504	0.820	peptidase activator activity
GO:0061135	0.819	endopeptidase regulator activity
GO:0042802	0.811	identical protein binding
GO:0061133	0.801	endopeptidase activator activity
GO:0038023	0.568	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050868	0.991	negative regulation of T cell activation
GO:0001817	0.990	regulation of cytokine production
GO:0050672	0.988	negative regulation of lymphocyte proliferation
GO:0042129	0.986	regulation of T cell proliferation
GO:0009987	0.978	cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.974	positive regulation of cellular process
GO:0001818	0.974	negative regulation of cytokine production
GO:0042130	0.971	negative regulation of T cell proliferation
GO:0046636	0.959	negative regulation of alpha-beta T cell activation
GO:0051240	0.958	positive regulation of multicellular organismal process
GO:2000514	0.954	regulation of CD4-positive, alpha-beta T cell activation
GO:0050793	0.951	regulation of developmental process
GO:0010628	0.950	positive regulation of gene expression
GO:0002684	0.943	positive regulation of immune system process
GO:0045785	0.941	positive regulation of cell adhesion
GO:0045595	0.940	regulation of cell differentiation
GO:0046640	0.922	regulation of alpha-beta T cell proliferation
GO:0051094	0.910	positive regulation of developmental process
GO:1902105	0.905	regulation of leukocyte differentiation
GO:0045597	0.882	positive regulation of cell differentiation
GO:0032649	0.871	regulation of type II interferon production
GO:0050896	0.863	response to stimulus
GO:0050776	0.845	regulation of immune response
GO:0032689	0.832	negative regulation of type II interferon production
GO:0023052	0.809	signaling
GO:0022409	0.809	positive regulation of cell-cell adhesion
GO:0032653	0.790	regulation of interleukin-10 production
GO:0080090	0.769	regulation of primary metabolic process
GO:0045619	0.758	regulation of lymphocyte differentiation
GO:0051716	0.748	cellular response to stimulus
GO:0002696	0.741	positive regulation of leukocyte activation
GO:0007154	0.727	cell communication
GO:0045589	0.726	regulation of regulatory T cell differentiation
GO:0051171	0.725	regulation of nitrogen compound metabolic process
GO:0007165	0.716	signal transduction
GO:0050870	0.702	positive regulation of T cell activation
GO:0010712	0.602	regulation of collagen metabolic process
GO:0030162	0.585	regulation of proteolysis
GO:1903555	0.569	regulation of tumor necrosis factor superfamily cytokine production
GO:0010720	0.554	positive regulation of cell development
GO:1902107	0.524	positive regulation of leukocyte differentiation
GO:0065009	0.518	regulation of molecular function
GO:1903556	0.403	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0032501	0.393	multicellular organismal process
GO:0071704	0.377	organic substance metabolic process
GO:0044238	0.365	primary metabolic process
GO:0002376	0.344	immune system process
GO:0032720	0.333	negative regulation of tumor necrosis factor production
GO:0045582	0.310	positive regulation of T cell differentiation
GO:0006807	0.305	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.524	cell surface
GO:0005622	0.380	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]