StarFunc result for job id Q9H7N4

User Input

>input (1312 residues)
MEEEDESRGKTEESGEDRGDGPPDRDPTLSPSAFILRAIQQAVGSSLQGDLPNDKDGSRC
HGLRWRRCRSPRSEPRSQESGGTDTATVLDMATDSFLAGLVSVLDPPDTWVPSRLDLRPG
ESEDMLELVAEVRIGDRDPIPLPVPSLLPRLRAWRTGKTVSPQSNSSRPTCARHLTLGTG
DGGPAPPPAPSSASSSPSPSPSSSSPSPPPPPPPPAPPAPPAPRFDIYDPFHPTDEAYSP
PPAPEQKYDPFEPTGSNPSSSAGTPSPEEEEEEEEEEEEEEEDEEEEEGLSQSISRISET
LAGIYDDNSLSQDFPGDESPRPDAQPTQPTPAPGTPPQVDSTRADGAMRRRVFVVGTEAE
ACREGKVSVEVVTAGGAALPPPLLPPGDSEIEEGEIVQPEEEPRLALSLFRPGGRAARPT
PAASATPTAQPLPQPPAPRAPEGDDFLSLHAESDGEGALQVDLGEPAPAPPAADSRWGGL
DLRRKILTQRRERYRQRSPSPAPAPAPAAAAGPPTRKKSRRERKRSGEAKEAASSSSGTQ
PAPPAPASPWDSKKHRSRDRKPGSHASSSARRRSRSRSRSRSTRRRSRSTDRRRGGSRRS
RSREKRRRRRRSASPPPATSSSSSSRRERHRGKHRDGGGSKKKKKRSRSRGEKRSGDGSE
KAPAPAPPPSGSTSCGDRDSRRRGAVPPSIQDLTDHDLFAIKRTITVGRLDKSDPRGPSP
APASSPKREVLYDSEGLSGEERGGKSSQKDRRRSGAASSSSSSREKGSRRKALDGGDRDR
DRDRDRDRDRSSKKARPPKESAPSSGPPPKPPVSSGSGSSSSSSSCSSRKVKLQSKVAVL
IREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKT
KVKAKAGAKKTKGTKGKTKPSKTRKKVRSGGGSGGSGGQVSLKKSKADSCSQAAGTKGAE
ETSWSGEERAAKVPSTPPPKAAPPPPALTPDSQTVDSSCKTPEVSFLPEEATEEAGVRGG
AEEEEEEEEEEEEEEEEEEQQPATTTATSTAAAAPSTAPSAGSTAGDSGAEDGPASRVSQ
LPTLPPPMPWNLPAGVDCTTSGVLALTALLFKMEEANLASRAKAQELIQATNQILSHRKP
PSSLGMTPAPVPTSLGLPPGPSSYLLPGSLPLGGCGSTPPTPTGLAATSDKREGSSSSEG
RGDTDKYLKKLHTQERAVEEVKLAIKPYYQKKDITKEEYKDILRKAVHKICHSKSGEINP
VKVSNLVRAYVQRYRYFRKHGRKPGDPPGPPRPPKEPGPPDKGGPGLPLPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63624	0.314	0.322	0.000	1258	0.845	0.882	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
2	AFDB:Q9H7N4	1.000	1.000	0.000	1312	1.000	1.000	Q9H7N4.pdb.gz	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
3	AFDB:Q63625	0.069	0.057	3.600E-12	1685	0.216	0.169	Q63625.pdb.gz	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
4	AFDB:Q9P1Y6	0.067	0.053	3.603E-10	1649	0.216	0.172	Q9P1Y6.pdb.gz	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
5	AFDB:E7F4D0	0.046	0.047	3.397E-4	1278	0.171	0.176	E7F4D0.pdb.gz	E7F4D0_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=3
6	AFDB:Q9VMD0	0.045	0.039	3.398E-3	1659	0.140	0.111	Q9VMD0.pdb.gz	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
7	AFDB:A0A0B4KHZ9	0.037	0.041	5.254E-3	1151	0.160	0.182	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
8	AFDB:P20482	0.034	0.033	1.042E-2	1383	0.130	0.124	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
9	AFDB:Q5SW79	0.050	0.044	1.514E-2	1584	0.149	0.123	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
10	AFDB:Q9VQI9	0.043	0.042	3.851E-2	1673	0.160	0.126	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
11	PDB:7qsmW	0.040	0.270	3.274E-1	116	0.012	0.138	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	PDB:5ze9F	0.034	0.083	8.864E-1	456	0.008	0.024	5ze9F.pdb.gz	Metastable asymmetrical structure of a shaftless V1motor.
13	PDB:6mksA	0.035	0.308	1.068	90	0.008	0.122	6mksA.pdb.gz
14	PDB:4ip8A	0.039	0.289	2.255	105	0.008	0.095	4ip8A.pdb.gz
15	PDB:4v6wCR	0.047	0.232	3.486	203	0.009	0.059	4v6wCR.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:6jbqF	0.048	0.225	3.949	186	0.008	0.054	6jbqF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
17	PDB:6jcxF	0.055	0.321	3.949	186	0.008	0.059	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
18	PDB:1or7B	0.042	0.215	4.202	164	0.007	0.055	1or7B.pdb.gz
19	PDB:7aqrW	0.038	0.283	4.202	112	0.005	0.062	7aqrW.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
20	PDB:5n9jZ	0.030	0.228	4.759	119	0.010	0.109	5n9jZ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63624	0.0	769	1258	0.428	0.446	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
2	Q9H7N4	0.0	2539	1312	1.000	1.000	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
3	Q9P1Y6	1.67e-37	156	1649	0.062	0.049	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
4	Q63625	1.33e-36	154	1685	0.059	0.046	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
5	F8VXG7	1.01e-27	124	1271	0.043	0.044	F8VXG7_HUMAN SR-related CTD associated factor 11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=1
6	Q99590	1.85e-27	124	1463	0.043	0.038	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
7	Q9VNE0	1.14e-23	111	2296	0.035	0.020	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10232 Med8	6.6e+02	11.3	Mediator of RNA polymerase II transcription complex subunit 8
2	PF00995 Sec1	5.3e+02	11.2	Sec1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387051	0.901	Myelin-associated neurite-outgrowth inhibitor
2	9606.ENSP00000319104	0.897	Transcription elongation factor SPT6
3	9606.ENSP00000394510	0.895	Proline-rich protein 12
4	9606.ENSP00000326261	0.885	Serine/arginine repetitive matrix protein 1
5	9606.ENSP00000382269	0.842	E3 ubiquitin-protein ligase HECTD1
6	9606.ENSP00000342181	0.818	Signal recognition particle subunit SRP72
7	9606.ENSP00000367938	0.788	Cytochrome c oxidase subunit 7A-related protein, mitochondrial
8	9606.ENSP00000246794	0.778	Transmembrane gamma-carboxyglutamic acid protein 2
9	9606.ENSP00000357928	0.757	Pre-mRNA-processing factor 17
10	9606.ENSP00000482218	0.731	Bcl-2-like protein 12
11	9606.ENSP00000346378	0.664	Amyloid-beta A4 precursor protein-binding family B member 3
12	9606.ENSP00000309714	0.650	SH3 and PX domain-containing protein 2B
13	9606.ENSP00000363458	0.649	Low density lipoprotein receptor adapter protein 1
14	9606.ENSP00000354671	0.648	Microtubule-associated serine/threonine-protein kinase 2
15	9606.ENSP00000430985	0.646	Ankyrin repeat domain-containing protein 6
16	9606.ENSP00000371331	0.627	Troponin I, fast skeletal muscle
17	9606.ENSP00000368872	0.610	Protein inscuteable homolog
18	9606.ENSP00000295461	0.600	Magnesium transporter NIPA3
19	9606.ENSP00000385478	0.573	D-ribitol-5-phosphate cytidylyltransferase
20	9606.ENSP00000381992	0.550	Septin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099122	1.000	RNA polymerase II C-terminal domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0008152	0.988	metabolic process
GO:0044238	0.979	primary metabolic process
GO:0071704	0.978	organic substance metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0043170	0.925	macromolecule metabolic process
GO:0034654	0.925	nucleobase-containing compound biosynthetic process
GO:0006351	0.907	DNA-templated transcription
GO:0016071	0.891	mRNA metabolic process
GO:0006396	0.871	RNA processing
GO:0006397	0.835	mRNA processing
GO:0006366	0.805	transcription by RNA polymerase II
GO:0065007	0.649	biological regulation
GO:0050789	0.483	regulation of biological process
GO:0050794	0.473	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.781	protein-containing complex
GO:0005737	0.732	cytoplasm
GO:0016604	0.490	nuclear body
GO:0140513	0.352	nuclear protein-containing complex
GO:0016607	0.305	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]