StarFunc result for job id Q9H7P6

User Input

>input (319 residues)
MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRN
RAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIK
DTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIG
ELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPRHISLTLPATFRGRNSTRTD
YEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIKSLAEIEKEYEYSFRTEQ
SAAARLPPSPTRCQQIPQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H7P6	1.000	1.000	8.912E-55	319	1.000	1.000	Q9H7P6.pdb.gz	MB12B_HUMAN Multivesicular body subunit 12B OS=Homo sapiens OX=9606 GN=MVB12B PE=1 SV=2
2	AFDB:A0A024R7L6	0.451	0.521	8.804E-20	273	0.285	0.333	A0A024R7L6.pdb.gz
3	AFDB:Q17687	0.467	0.535	1.155E-18	277	0.254	0.292	Q17687.pdb.gz	Q17687_CAEEL ESCRT-I complex subunit MVB12A OS=Caenorhabditis elegans OX=6239 GN=mvb-12 PE=1 SV=1
4	AFDB:E9PQA6	0.438	0.508	3.923E-17	273	0.248	0.289	E9PQA6.pdb.gz	E9PQA6_HUMAN Multivesicular body subunit 12A OS=Homo sapiens OX=9606 GN=MVB12A PE=1 SV=1
5	PDB:8a1dA	0.256	0.166	5.145E-2	533	0.085	0.051	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
6	AFDB:Q8BX90	0.077	0.033	6.406E-2	1198	0.119	0.032	Q8BX90.pdb.gz	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
7	PDB:6sb3A	0.240	0.143	6.806E-2	604	0.085	0.045	6sb3A.pdb.gz
8	AFDB:Q05196	0.078	0.046	8.474E-2	682	0.138	0.065	Q05196.pdb.gz	PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana OX=3702 GN=PAB5 PE=1 SV=3
9	PDB:6u23A	0.206	0.127	1.409E-1	583	0.066	0.036	6u23A.pdb.gz
10	AFDB:A2WQE4	0.101	0.098	2.320E-1	333	0.113	0.108	A2WQE4.pdb.gz	NAC26_ORYSI NAC domain-containing protein 26 OS=Oryza sativa subsp. indica OX=39946 GN=NAC26 PE=1 SV=1
11	AFDB:Q57ZF7	0.101	0.052	2.595E-1	746	0.110	0.047	Q57ZF7.pdb.gz	Q57ZF7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.630 PE=4 SV=1
12	AFDB:Q90X22	0.079	0.031	2.902E-1	1276	0.103	0.026	Q90X22.pdb.gz
13	AFDB:Q582I8	0.122	0.067	3.246E-1	735	0.157	0.068	Q582I8.pdb.gz	Q582I8_TRYB2 FHA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.250 PE=4 SV=1
14	PDB:7v9aC	0.084	0.073	4.562E-1	393	0.038	0.031	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
15	PDB:5aj0AH	0.076	0.105	5.706E-1	191	0.060	0.099	5aj0AH.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:4adfM	0.077	0.119	8.928E-1	191	0.044	0.073	4adfM.pdb.gz
17	PDB:5iv5BE	0.099	0.145	9.442E-1	165	0.047	0.091	5iv5BE.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:4v6wCJ	0.112	0.162	1.056	182	0.056	0.099	4v6wCJ.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:1k4dB	0.137	0.181	1.117	212	0.063	0.094	1k4dB.pdb.gz
20	PDB:1k8wA	0.081	0.083	1.397	304	0.044	0.046	1k8wA.pdb.gz	Cocrystal structure of a tRNA Psi55 pseudouridine synthase: nucleotide flipping by an RNA-modifying enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7P6	0.0	659	319	1.000	1.000	MB12B_HUMAN Multivesicular body subunit 12B OS=Homo sapiens OX=9606 GN=MVB12B PE=1 SV=2
2	Q96EY5	1.37e-44	155	273	0.317	0.370	MB12A_HUMAN Multivesicular body subunit 12A OS=Homo sapiens OX=9606 GN=MVB12A PE=1 SV=1
3	Q17687	8.42e-32	121	277	0.241	0.278	Q17687_CAEEL ESCRT-I complex subunit MVB12A OS=Caenorhabditis elegans OX=6239 GN=mvb-12 PE=1 SV=1
4	E9PQA6	4.27e-30	117	273	0.248	0.289	E9PQA6_HUMAN Multivesicular body subunit 12A OS=Homo sapiens OX=9606 GN=MVB12A PE=1 SV=1
5	Q9VL78	0.099	36.6	439	0.103	0.075	FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster OX=7227 GN=Fkbp59 PE=1 SV=1
6	A0A0A0MQZ8	0.42	35.0	866	0.107	0.039	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
7	Q8IWG5	0.43	35.0	866	0.107	0.039	Q8IWG5_HUMAN ANKHD1 protein OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10240 DUF2464	8.4e-81	282.9	Multivesicular body subunit 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251968	0.999	Tumor susceptibility gene 101 protein
2	9606.ENSP00000267202	0.999	Vacuolar protein sorting-associated protein 37B
3	9606.ENSP00000366565	0.998	Vacuolar protein sorting-associated protein 28 homolog
4	9606.ENSP00000318629	0.992	Vacuolar protein sorting-associated protein 37A
5	9606.ENSP00000297661	0.982	Ubiquitin-associated protein 1
6	9606.ENSP00000301765	0.977	Vacuolar protein sorting-associated protein 37C
7	9606.ENSP00000367299	0.975	Vacuolar protein-sorting-associated protein 36
8	9606.ENSP00000320416	0.971	Vacuolar protein sorting-associated protein 37D
9	9606.ENSP00000317468	0.958	Charged multivesicular body protein 6
10	9606.ENSP00000421380	0.958	Vacuolar-sorting protein SNF8
11	9606.ENSP00000253794	0.952	Vacuolar protein-sorting-associated protein 25
12	9606.ENSP00000469240	0.952	Charged multivesicular body protein 2a
13	9606.ENSP00000331201	0.948	Hepatocyte growth factor-regulated tyrosine kinase substrate
14	9606.ENSP00000405575	0.946	Charged multivesicular body protein 3
15	9606.ENSP00000474823	0.946	annotation not available
16	9606.ENSP00000366746	0.942	Signal transducing adapter molecule 1
17	9606.ENSP00000217402	0.939	Charged multivesicular body protein 4b
18	9606.ENSP00000324205	0.934	Charged multivesicular body protein 4a
19	9606.ENSP00000324810	0.934	Multivesicular body subunit 12A
20	9606.ENSP00000432279	0.930	Charged multivesicular body protein 1b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0046755	0.989	viral budding
GO:0043162	0.989	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0023051	0.973	regulation of signaling
GO:0010646	0.973	regulation of cell communication
GO:0009966	0.930	regulation of signal transduction
GO:0042058	0.899	regulation of epidermal growth factor receptor signaling pathway
GO:0071840	0.551	cellular component organization or biogenesis
GO:0016043	0.502	cellular component organization
GO:0006996	0.463	organelle organization
GO:0051179	0.378	localization
GO:0006810	0.311	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0010008	0.999	endosome membrane
GO:0098796	0.998	membrane protein complex
GO:0005886	0.998	plasma membrane
GO:0005634	0.998	nucleus
GO:0036452	0.998	ESCRT complex
GO:0070062	0.997	extracellular exosome
GO:0000813	0.994	ESCRT I complex
GO:0005770	0.992	late endosome
GO:0005769	0.938	early endosome
GO:0031981	0.337	nuclear lumen
GO:0043232	0.302	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]