StarFunc result for job id Q9H7P9

User Input

>input (1386 residues)
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAPAAPTMASPRGSGSSTSLSTVGS
EGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGLEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPVLEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSVIRRGRR
QSEPVKDPYVMFPQNAKPGFKHAGSEGELYPPESQPPVSGSAPPEDLEDAGPPTLDPSGT
SITEEILELLNQRGLRDPGPSTHDIPKFPGDSQVPGDSETLTFQALPSRDSSEEEEEEEE
GLEMDERGPSPLHVLEGLESSIAAEMPSIPCLTKIPDVPNLPEIPSRCEIPEGSRLPSLS
DISDVFEMPCLPAIPSVPNTPSLSSTPTLSCDSWLQGPLQEPAEAPATRRELFSGSNPGK
LGEPPSGGKAGPEEDEEGVSFTDFQPQDVTQHQGFPDELAFRSCSEIRSAWQALEQGQLA
RPGFPEPLLILEDSDLGGDSGSGKAGAPSSERTASRVRELARLYSERIQQMQRAETRASA
NAPRRRPRVLAQPQPSPCLPQEQAEPGLLPAFGHVLVCELAFPLTCAQESVPLGPAVWVQ
AAIPLSKQGGSPDGQGLHVSNLPKQDLPGIHVSAATLLPEQGGSRHVQAPAATPLPKQEG
PLHLQVPALTTFSDQGHPEIQVPATTPLPEHRSHMVIPAPSTAFCPEQGHCADIHVPTTP
ALPKEICSDFTVSVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSW
HGSSLDPQGPGDTLPPLPCHLPDLQIPGTSPLPAHGSHLDHRIPANAPLSLSQELPDTQV
PATTPLPLPQVLTDIWVQALPTSPKQGSLPDIQGPAAAPPLPEPSLTDTQVQKLTPSLEQ
KSLIDAHVPAATPLPERGGSLDIQGLSPTPVQTTMVLSKPGGSLASHVARLESSDLTPPH
SPPPSSRQLLGPNAAALSRYLAASYISQSLARRQGPGGGAPAASRGSWSSAPTSRASSPP
PQPQPPPPPARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPALLASTQESMGLHRAQGAP
DAPFHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H7P9	0.999	0.999	0.000	1386	1.000	1.000	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
2	AFDB:A1L390	0.240	0.272	2.888E-39	1219	0.229	0.261	A1L390.pdb.gz	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
3	AFDB:Q9ULL1	0.244	0.244	1.287E-36	1385	0.247	0.248	Q9ULL1.pdb.gz	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
4	PDB:7rx9A	0.125	0.389	4.216E-18	432	0.071	0.229	7rx9A.pdb.gz
5	PDB:4mt6A	0.178	0.523	1.607E-16	389	0.069	0.244	4mt6A.pdb.gz
6	AFDB:A8DZ19	0.154	0.161	8.131E-16	1310	0.160	0.169	A8DZ19.pdb.gz	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
7	PDB:4gouA	0.125	0.328	1.251E-7	507	0.028	0.077	4gouA.pdb.gz
8	AFDB:Q38AE6	0.068	0.077	1.931E-4	1203	0.146	0.169	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
9	PDB:6bbpA	0.078	0.166	7.505E-4	520	0.040	0.106	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
10	AFDB:P35658	0.041	0.031	1.059E-3	2090	0.172	0.114	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
11	PDB:3ljuX	0.067	0.217	1.262E-3	373	0.022	0.080	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	AFDB:Q57Y65	0.049	0.044	1.959E-3	1617	0.167	0.143	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
13	AFDB:Q6PAC4	0.038	0.041	2.053E-3	1279	0.174	0.188	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
14	PDB:6u3eA	0.075	0.201	3.250E-3	397	0.043	0.151	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	AFDB:A0A1D8PD52	0.040	0.042	4.587E-3	1287	0.094	0.101	A0A1D8PD52.pdb.gz	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1
16	AFDB:Q9DF49	0.074	0.091	5.042E-3	1074	0.117	0.151	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
17	PDB:4mk0A	0.065	0.132	5.732E-3	631	0.023	0.051	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:5yqrA	0.077	0.346	7.260E-3	268	0.018	0.093	5yqrA.pdb.gz
19	PDB:3pvuA	0.064	0.134	8.772E-3	609	0.020	0.046	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:3uzsA	0.069	0.143	2.367E-2	609	0.027	0.061	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7P9	0.0	2755	1386	1.000	1.000	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
2	A1L390	5.76e-104	361	1219	0.144	0.163	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
3	Q5JYA6	2.00e-102	359	1385	0.136	0.136	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1
4	Q9ULL1	2.00e-102	359	1385	0.136	0.136	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
5	D4YWB8	1.89e-57	216	775	0.091	0.163	D4YWB8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
6	A0A0B4KFB7	3.88e-57	216	878	0.092	0.146	A0A0B4KFB7_DROME Guanine nucleotide exchange factor in mesoderm, isoform F OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=4 SV=1
7	Q9XXM9	4.47e-57	217	919	0.091	0.137	Q9XXM9_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
8	G5EER5	9.59e-57	216	952	0.091	0.132	G5EER5_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
9	G5EF62	1.22e-56	216	972	0.091	0.130	G5EF62_CAEEL Protein vav OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
10	B6GUP8	1.36e-56	216	958	0.091	0.132	B6GUP8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
11	A1ZBA1	4.07e-56	217	1549	0.092	0.083	A1ZBA1_DROME FI17866p1 OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=2
12	Q8MSP7	1.60e-55	214	1240	0.092	0.103	Q8MSP7_DROME AT03020p OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
13	B3DN64	1.91e-55	214	1237	0.092	0.103	B3DN64_DROME Guanine nucleotide exchange factor in mesoderm, isoform G OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
14	A0A024RDM6	1.01e-31	135	652	0.076	0.161	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
15	Q96N96	1.01e-31	135	652	0.076	0.161	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
16	Q8C067	9.92e-31	134	928	0.071	0.107	Q8C067_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
17	A2AET8	1.61e-30	133	944	0.071	0.105	A2AET8_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=4 SV=1
18	Q8BLE2	3.83e-30	132	1031	0.071	0.096	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
19	Q99N72	7.27e-30	131	928	0.071	0.106	Q99N72_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=1 SV=1
20	Q7TNJ5	1.10e-29	130	944	0.071	0.104	Q7TNJ5_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.029	26.3	PH domain
2	PF00621 RhoGEF	6.6e-36	135.7	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392906

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481878	0.752	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
2	9606.ENSP00000470252	0.685	Transcription elongation factor SPT5
3	9606.ENSP00000334448	0.677	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
4	9606.ENSP00000399745	0.642	Muscarinic acetylcholine receptor M2
5	9606.ENSP00000383118	0.610	Cell division control protein 42 homolog
6	9606.ENSP00000298694	0.590	Rho guanine nucleotide exchange factor 40
7	9606.ENSP00000400175	0.581	Transforming protein RhoA
8	9606.ENSP00000357177	0.570	Rho guanine nucleotide exchange factor 11
9	9606.ENSP00000344961	0.568	Pleckstrin homology and RhoGEF domain containing G7
10	9606.ENSP00000343027	0.538	Guanine nucleotide-binding protein G(i) subunit alpha-1
11	9606.ENSP00000441913	0.533	Rho guanine nucleotide exchange factor 28
12	9606.ENSP00000377710	0.527	Four and a half LIM domains protein 1
13	9606.ENSP00000422007	0.522	Alpha-actinin-3
14	9606.ENSP00000314343	0.517	Mediator of RNA polymerase II transcription subunit 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.985	molecular function regulator activity
GO:0005085	0.982	guanyl-nucleotide exchange factor activity
GO:0019899	0.318	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0016043	0.978	cellular component organization
GO:1902903	0.948	regulation of supramolecular fiber organization
GO:0110053	0.943	regulation of actin filament organization
GO:0044087	0.942	regulation of cellular component biogenesis
GO:0065008	0.929	regulation of biological quality
GO:0043254	0.892	regulation of protein-containing complex assembly
GO:0032271	0.860	regulation of protein polymerization
GO:0032535	0.853	regulation of cellular component size
GO:0030832	0.842	regulation of actin filament length
GO:0008064	0.674	regulation of actin polymerization or depolymerization
GO:0030833	0.531	regulation of actin filament polymerization
GO:0050896	0.419	response to stimulus
GO:0023051	0.353	regulation of signaling
GO:0010646	0.353	regulation of cell communication
GO:0009966	0.339	regulation of signal transduction
GO:1902531	0.308	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.849	membrane
GO:0071944	0.534	cell periphery
GO:0043226	0.471	organelle
GO:0005886	0.471	plasma membrane
GO:0043227	0.435	membrane-bounded organelle
GO:0043231	0.431	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]