StarFunc result for job id Q9H7S9

User Input

>input (590 residues)
MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHT
GHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGL
GAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSS
SSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGG
ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSS
SPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPG
HPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSH
LRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTL
GLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CL69	0.262	0.261	1.383E-75	594	0.956	0.949	P0CL69.pdb.gz	ZN703_MOUSE Zinc finger protein 703 OS=Mus musculus OX=10090 GN=Znf703 PE=1 SV=1
2	AFDB:Q90ZE2	0.187	0.187	6.874E-39	589	0.553	0.553	Q90ZE2.pdb.gz	ZN703_DANRE Zinc finger protein 703 OS=Danio rerio OX=7955 GN=znf703 PE=1 SV=1
3	AFDB:Q6UFS5	0.159	0.165	1.695E-38	563	0.519	0.544	Q6UFS5.pdb.gz	ZN503_DANRE Zinc finger protein 503 OS=Danio rerio OX=7955 GN=znf503 PE=1 SV=1
4	AFDB:E9QAP7	0.062	0.040	9.034E-2	1042	0.186	0.106	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
5	AFDB:Q9M9N3	0.069	0.056	1.469E-1	769	0.163	0.125	Q9M9N3.pdb.gz	Q9M9N3_ARATH T17B22.17 protein OS=Arabidopsis thaliana OX=3702 GN=PWO1 PE=1 SV=1
6	AFDB:Q8WTC2	0.061	0.063	2.560E-1	567	0.139	0.145	Q8WTC2.pdb.gz	Q8WTC2_DROME Suppressor of cytokine signaling SOCS36E-II OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
7	AFDB:Q14004	0.051	0.027	3.622E-1	1512	0.200	0.078	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
8	AFDB:E7EX82	0.059	0.048	3.882E-1	828	0.195	0.139	E7EX82.pdb.gz	E7EX82_HUMAN Polyhomeotic homolog 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
9	AFDB:Q8SX72	0.062	0.047	4.161E-1	868	0.200	0.136	Q8SX72.pdb.gz	Q8SX72_DROME LD30050p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=1
10	AFDB:Q09XV5	0.053	0.018	4.781E-1	2582	0.159	0.036	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
11	PDB:6d9j9	0.042	0.031	5.658	856	0.014	0.009	6d9j9.pdb.gz	Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
12	PDB:5wg6A	0.037	0.041	6.064	517	0.032	0.037	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
13	PDB:7np7D1	0.046	0.054	7.469	485	0.019	0.023	7np7D1.pdb.gz
14	PDB:5nfrA	0.031	0.053	8.006	313	0.007	0.013	5nfrA.pdb.gz
15	PDB:7pd3z	0.033	0.060	8.006	311	0.005	0.010	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
16	PDB:4v6wCh	0.032	0.100	8.581	123	0.015	0.073	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CL69	0.0	827	594	0.953	0.946	ZN703_MOUSE Zinc finger protein 703 OS=Mus musculus OX=10090 GN=Znf703 PE=1 SV=1
2	Q9H7S9	0.0	1118	590	1.000	1.000	ZN703_HUMAN Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1
3	Q90ZE2	2.23e-161	475	589	0.537	0.538	ZN703_DANRE Zinc finger protein 703 OS=Danio rerio OX=7955 GN=znf703 PE=1 SV=1
4	Q6UFS5	1.88e-156	462	563	0.519	0.544	ZN503_DANRE Zinc finger protein 503 OS=Danio rerio OX=7955 GN=znf503 PE=1 SV=1
5	Q96F45	3.01e-147	441	646	0.542	0.495	ZN503_HUMAN Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503 PE=1 SV=1
6	Q7TMA2	1.44e-142	429	652	0.564	0.511	ZN503_MOUSE Zinc finger protein 503 OS=Mus musculus OX=10090 GN=Znf503 PE=1 SV=1
7	Q24423	3.43e-08	58.5	537	0.124	0.136	NOC_DROME Zinc finger protein Noc OS=Drosophila melanogaster OX=7227 GN=noc PE=1 SV=1
8	Q9VJS8	8.94e-08	57.4	553	0.080	0.085	ELBOW_DROME Zinc finger protein Elbow OS=Drosophila melanogaster OX=7227 GN=elB PE=1 SV=4
9	Q8TD94	0.022	39.7	323	0.027	0.050	KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens OX=9606 GN=KLF14 PE=2 SV=2
10	M9PJG1	0.026	40.0	726	0.029	0.023	M9PJG1_DROME Sp1, isoform F OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
11	A8JUN6	0.027	40.0	715	0.029	0.024	A8JUN6_DROME Sp1, isoform D OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=2
12	R9PY21	0.027	40.0	720	0.029	0.024	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
13	Q9U1K4	0.028	39.7	523	0.029	0.033	Q9U1K4_DROME C2H2 zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
14	Q8IRM5	0.029	39.7	520	0.029	0.033	Q8IRM5_DROME Sp1, isoform B OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
15	Q6P0J3	0.031	39.7	437	0.029	0.039	SP8_DANRE Transcription factor Sp8 OS=Danio rerio OX=7955 GN=sp8b PE=2 SV=1
16	A0A8I6B4P2	0.038	39.3	801	0.027	0.020	A0A8I6B4P2_RAT Sp4 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp4 PE=4 SV=1
17	Q02446	0.038	39.3	784	0.027	0.020	SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2
18	A0A3B3IRW4	0.040	39.3	767	0.027	0.021	A0A3B3IRW4_HUMAN Sp4 transcription factor OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=1
19	Q62445	0.043	39.3	782	0.027	0.020	SP4_MOUSE Transcription factor Sp4 OS=Mus musculus OX=10090 GN=Sp4 PE=2 SV=2
20	Q6IMK1	0.058	38.5	410	0.031	0.044	Q6IMK1_RAT Sp7 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12402 nlz1	3.8e-17	73.7	NocA-like zinc-finger protein 1
2	PF00096 zf-C2H2	24	16.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	1.7e+02	14.5	C2H2-type zinc finger
4	PF18366 zf_ZIC	6.7e+02	11.8	Zic proteins zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276461	0.829	Erlin-2
2	9606.ENSP00000483236	0.801	DDB1- and CUL4-associated factor 7
3	9606.ENSP00000333551	0.765	Pyridoxal phosphate homeostasis protein
4	9606.ENSP00000382770	0.704	Potassium channel subfamily U member 1
5	9606.ENSP00000262715	0.660	Telomerase protein component 1
6	9606.ENSP00000398798	0.633	Zinc finger protein 142
7	9606.ENSP00000392553	0.602	Phospholipid phosphatase 5
8	9606.ENSP00000248929	0.598	Small G protein signaling modulator 3
9	9606.ENSP00000331342	0.587	Rab11 family-interacting protein 1
10	9606.ENSP00000441875	0.582	Prohibitin-2
11	9606.ENSP00000239374	0.572	Coiled-coil domain containing 170
12	9606.ENSP00000401946	0.562	Trinucleotide repeat-containing gene 6B protein
13	9606.ENSP00000393312	0.560	Fibroblast growth factor receptor 1
14	9606.ENSP00000258499	0.545	Ubiquitin carboxyl-terminal hydrolase 44
15	9606.ENSP00000333836	0.544	Fidgetin
16	9606.ENSP00000406367	0.528	Adhesion G protein-coupled receptor A2
17	9606.ENSP00000360526	0.527	Zinc finger protein 217
18	9606.ENSP00000380352	0.517	Phospholipase DDHD2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140297	0.902	DNA-binding transcription factor binding
GO:0003676	0.497	nucleic acid binding
GO:0043565	0.425	sequence-specific DNA binding
GO:0003690	0.380	double-stranded DNA binding
GO:0140110	0.346	transcription regulator activity
GO:1990837	0.339	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032502	0.983	developmental process
GO:0048523	0.982	negative regulation of cellular process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0009966	0.968	regulation of signal transduction
GO:0010468	0.953	regulation of gene expression
GO:0080090	0.950	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0010605	0.948	negative regulation of macromolecule metabolic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0048518	0.910	positive regulation of biological process
GO:0019219	0.905	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.895	regulation of RNA biosynthetic process
GO:0006355	0.894	regulation of DNA-templated transcription
GO:0048522	0.889	positive regulation of cellular process
GO:0031327	0.887	negative regulation of cellular biosynthetic process
GO:0042127	0.831	regulation of cell population proliferation
GO:0051172	0.818	negative regulation of nitrogen compound metabolic process
GO:0045892	0.742	negative regulation of DNA-templated transcription
GO:0090287	0.713	regulation of cellular response to growth factor stimulus
GO:0090092	0.679	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903844	0.671	regulation of cellular response to transforming growth factor beta stimulus
GO:0048856	0.670	anatomical structure development
GO:0050896	0.626	response to stimulus
GO:0017015	0.581	regulation of transforming growth factor beta receptor signaling pathway
GO:0048869	0.441	cellular developmental process
GO:0051716	0.402	cellular response to stimulus
GO:0050793	0.339	regulation of developmental process
GO:0030154	0.323	cell differentiation
GO:0048513	0.321	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0032991	0.979	protein-containing complex
GO:0005829	0.586	cytosol
GO:0016363	0.487	nuclear matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]