StarFunc result for job id Q9H7T0

User Input

>input (1116 residues)
MESPLIYVSVLLLNIFEFSSGIVYNKDDTEKRFACSNKGFPQENEIIKLYLFLENLKIQC
FFQTENEIASKAMLSVFTSGGLAPSLGIMNSTYNGIFHFNLTLFSDRILWLVDIPRENIT
QSTDIAAVEEWLVRITLHHGLNIYATEGTLLDVIREPILQWTPGDVIPESEISKLYPHVV
DLKVTKCPCANDVALLGFIVDTIVDGVYIGITFGGFWHDYDTTWFNMTQTIYSQLQEEYE
DLSLVDMVLTNHFLVILTSLGLFVSEDLRYPSRHSLSFSRADFCGFERVDYVKGKLWYNE
RCFANREHFEVDYVTVTFERNRTLSESSSCFYSQEPFLEWVPCLPHIFKGIKIFPTVLTF
LVDQERGTGVYLFYNKVRKTAIASVSTLRNNEPNSQSKFPIFRFPSSFSSPVGMVFHPRS
HFLYAYGNQIWLSVDGGNTFQLIANFHDDIIKKTFHSFYTSAITFVSQRGKVYSTKAGMG
RYSAVGSVTERIFTLYYDHLGFLHKLTLGRFEASGPPTAFGNSRNLFGQPPDMGFETALA
PQHTSLDEIIFFAYVPENEPQETIYSKKFGNIHYGKVIHSGKTGRAYIRKVLQHTTPKGF
LSSVIAEMKEPFGLEEVNESSCLSSSLLINKAGNVYKLTLDSQVVQALFEDTDIEKTVVL
PGYSSFLITSILDNKNALAIATMPESAPNNMTFLKSTWFLYNFGQRNGRTWKIYSKPCNY
WFQHDDSPSLNIVKYIDLGNSYVLKAKVIRNAKGFRMLEIPLLTVFVGNPNLLEVTAEVT
FDDTDSYVITISAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPS
KFIPFEDWISGVHKDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFH
MSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINE
DGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKG
SELFHFRVTVISGVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQL
QGIHPWRTFQRWIRRNQEKFSSISLSELIHRSKSEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7eebE	0.897	0.950	0.000	1053	0.531	0.563	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
2	AFDB:A2RTF1	0.939	0.945	0.000	1109	0.557	0.561	A2RTF1.pdb.gz	CTSRB_MOUSE Cation channel sperm-associated auxiliary subunit beta OS=Mus musculus OX=10090 GN=Catsperb PE=1 SV=1
3	AFDB:Q9H7T0	1.000	1.000	0.000	1116	1.000	1.000	Q9H7T0.pdb.gz	CTSRB_HUMAN Cation channel sperm-associated auxiliary subunit beta OS=Homo sapiens OX=9606 GN=CATSPERB PE=2 SV=2
4	AFDB:C6KI89	0.494	0.484	4.745E-24	1145	0.115	0.112	C6KI89.pdb.gz	CTSG2_MOUSE Cation channel sperm-associated auxiliary subunit gamma 2 OS=Mus musculus OX=10090 GN=Catsperg2 PE=1 SV=1
5	AFDB:Q5SY80	0.474	0.545	8.279E-24	951	0.114	0.134	Q5SY80.pdb.gz	CTSRE_HUMAN Cation channel sperm-associated auxiliary subunit epsilon OS=Homo sapiens OX=9606 GN=CATSPERE PE=2 SV=1
6	AFDB:P0DP43	0.460	0.513	3.085E-23	985	0.092	0.105	P0DP43.pdb.gz	CTSRE_MOUSE Cation channel sperm-associated auxiliary subunit epsilon OS=Mus musculus OX=10090 GN=Catspere PE=1 SV=1
7	AFDB:Q6ZRH7	0.499	0.484	8.928E-23	1159	0.127	0.123	Q6ZRH7.pdb.gz	CTSRG_HUMAN Cation channel sperm-associated auxiliary subunit gamma OS=Homo sapiens OX=9606 GN=CATSPERG PE=2 SV=3
8	AFDB:Q86XM0	0.363	0.480	1.065E-21	798	0.091	0.127	Q86XM0.pdb.gz	CTSRD_HUMAN Cation channel sperm-associated auxiliary subunit delta OS=Homo sapiens OX=9606 GN=CATSPERD PE=1 SV=3
9	AFDB:E9Q9F6	0.365	0.480	1.678E-19	805	0.082	0.113	E9Q9F6.pdb.gz	CTSRD_MOUSE Cation channel sperm-associated auxiliary subunit delta OS=Mus musculus OX=10090 GN=Catsperd PE=1 SV=1
10	AFDB:A0A023GPK8	0.083	0.066	6.549E-9	1447	0.101	0.078	A0A023GPK8.pdb.gz	A0A023GPK8_DROME Friend of echinoid, isoform H OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
11	AFDB:F4KHD8	0.074	0.050	1.086E-8	1923	0.122	0.071	F4KHD8.pdb.gz	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
12	PDB:1nr0A	0.130	0.205	7.701E-8	610	0.058	0.107	1nr0A.pdb.gz
13	PDB:7lpsA	0.190	0.259	3.696E-7	781	0.056	0.081	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
14	PDB:7mq8LO	0.147	0.182	3.696E-7	848	0.053	0.070	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6n8sA	0.181	0.233	4.090E-7	834	0.070	0.094	6n8sA.pdb.gz
16	PDB:5wyjBE	0.172	0.239	4.302E-7	753	0.056	0.082	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
17	PDB:7mq8LR	0.183	0.253	5.267E-7	773	0.062	0.089	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7d5sBE	0.194	0.243	5.828E-7	865	0.067	0.087	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:6qk7A	0.104	0.100	7.505E-7	1161	0.067	0.065	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
20	PDB:7mq8LN	0.099	0.157	1.017E-6	671	0.050	0.083	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RTF1	0.0	1335	1109	0.563	0.566	CTSRB_MOUSE Cation channel sperm-associated auxiliary subunit beta OS=Mus musculus OX=10090 GN=Catsperb PE=1 SV=1
2	Q9H7T0	0.0	2316	1116	1.000	1.000	CTSRB_HUMAN Cation channel sperm-associated auxiliary subunit beta OS=Homo sapiens OX=9606 GN=CATSPERB PE=2 SV=2
3	Q9U0G5	2.0	35.0	2277	0.024	0.012	Q9U0G5_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0412700 PE=4 SV=1
4	Q581Q5	3.1	33.1	157	0.021	0.146	Q581Q5_TRYB2 Thioredoxin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1300 PE=4 SV=1
5	Q9C0D3	6.7	33.1	744	0.024	0.036	ZY11B_HUMAN Protein zyg-11 homolog B OS=Homo sapiens OX=9606 GN=ZYG11B PE=1 SV=2
6	Q38854	9.8	32.7	717	0.018	0.028	DXS_ARATH 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DXS PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15149 CATSPERB	3.8e-269	905.2	Cation channel sperm-associated protein subunit beta protein family
2	PF15902 Sortilin-Vps10	3.3e+02	11.4	Sortilin, neurotensin receptor 3,

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309052	0.984	Cation channel sperm-associated protein 1
2	9606.ENSP00000371037	0.945	Cation channel sperm-associated protein subunit delta
3	9606.ENSP00000386962	0.936	Cation channel sperm-associated protein subunit gamma
4	9606.ENSP00000390423	0.912	Cation channel sperm-associated protein 4
5	9606.ENSP00000378199	0.891	Heat shock-related 70 kDa protein 2
6	9606.ENSP00000282611	0.887	Cation channel sperm-associated protein 3
7	9606.ENSP00000371180	0.870	Cation channel sperm-associated protein 2
8	9606.ENSP00000334198	0.820	Voltage-dependent T-type calcium channel subunit alpha-1H
9	9606.ENSP00000360423	0.816	Voltage-dependent N-type calcium channel subunit alpha-1B
10	9606.ENSP00000355492	0.806	Cation channel sperm-associated protein subunit epsilon
11	9606.ENSP00000356545	0.794	Voltage-dependent R-type calcium channel subunit alpha-1E
12	9606.ENSP00000266376	0.790	Voltage-dependent L-type calcium channel subunit alpha-1C
13	9606.ENSP00000005284	0.781	Voltage-dependent calcium channel gamma-3 subunit
14	9606.ENSP00000262138	0.776	Voltage-dependent calcium channel gamma-4 subunit
15	9606.ENSP00000365441	0.775	Voltage-dependent L-type calcium channel subunit alpha-1F
16	9606.ENSP00000355192	0.772	Voltage-dependent L-type calcium channel subunit alpha-1S
17	9606.ENSP00000288139	0.770	Voltage-dependent L-type calcium channel subunit alpha-1D
18	9606.ENSP00000364801	0.769	Heat shock protein family A member 1B
19	9606.ENSP00000387882	0.762	Synaptotagmin like tandem C2 proteins
20	9606.ENSP00000301050	0.753	Voltage-dependent L-type calcium channel subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0032501	0.916	multicellular organismal process
GO:0007286	0.785	spermatid development
GO:0048469	0.739	cell maturation
GO:0065007	0.385	biological regulation
GO:0050789	0.353	regulation of biological process
GO:0050794	0.317	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.962	membrane-bounded organelle
GO:0032991	0.884	protein-containing complex
GO:0005891	0.826	voltage-gated calcium channel complex
GO:0005622	0.814	intracellular anatomical structure
GO:0005737	0.555	cytoplasm
GO:0043229	0.399	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]