StarFunc result for job id Q9H7Z6

User Input

>input (458 residues)
MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D1P2	0.837	0.837	2.583E-86	458	0.983	0.983	Q9D1P2.pdb.gz	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
2	AFDB:A0A2R8RHP9	0.821	0.692	5.147E-71	545	0.836	0.703	A0A2R8RHP9.pdb.gz
3	AFDB:O02193	0.777	0.440	8.146E-56	827	0.509	0.282	O02193.pdb.gz	MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster OX=7227 GN=mof PE=1 SV=1
4	AFDB:Q9LXD7	0.721	0.741	2.220E-49	445	0.465	0.479	Q9LXD7.pdb.gz	MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana OX=3702 GN=HAM2 PE=1 SV=1
5	PDB:7cmrA	0.570	0.990	9.095E-49	263	0.574	1.000	7cmrA.pdb.gz	The Crystal Structure of human MYST1 from Biortus.
6	AFDB:Q9FLF7	0.721	0.741	1.488E-48	445	0.445	0.458	Q9FLF7.pdb.gz	MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana OX=3702 GN=HAM1 PE=1 SV=1
7	AFDB:Q08649	0.683	0.702	4.802E-43	445	0.369	0.380	Q08649.pdb.gz	ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESA1 PE=1 SV=1
8	AFDB:Q960X4	0.668	0.570	2.708E-42	541	0.406	0.344	Q960X4.pdb.gz	TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
9	AFDB:Q9TYU5	0.676	0.676	1.020E-41	458	0.369	0.369	Q9TYU5.pdb.gz	TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans OX=6239 GN=mys-1 PE=2 SV=1
10	AFDB:C8VBH4	0.686	0.621	1.527E-41	508	0.393	0.354	C8VBH4.pdb.gz	ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=esa1 PE=3 SV=1
11	AFDB:E7EUP3	0.571	0.614	6.837E-41	425	0.376	0.405	E7EUP3.pdb.gz	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
12	PDB:7vvuP	0.545	0.907	4.304E-33	270	0.303	0.515	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:1s5kA	0.206	0.532	1.018E-2	153	0.044	0.131	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
14	PDB:6yugA	0.206	0.562	1.210E-2	143	0.059	0.189	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
15	PDB:3fb3B	0.183	0.461	2.417E-2	149	0.057	0.174	3fb3B.pdb.gz
16	PDB:2zcwA	0.119	0.239	3.618E-2	194	0.046	0.108	2zcwA.pdb.gz
17	PDB:2c27A	0.159	0.224	4.060E-2	301	0.041	0.063	2c27A.pdb.gz	The Substrate-Induced Conformational Change of Mycobacterium Tuberculosis Mycothiol Synthase.
18	PDB:1i1dD	0.173	0.442	4.557E-2	161	0.033	0.093	1i1dD.pdb.gz	The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
19	PDB:3mp8A	0.092	0.083	4.827E-2	513	0.026	0.023	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
20	PDB:2beiB	0.195	0.479	5.417E-2	159	0.057	0.164	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7SXF3	0.0	792	487	0.841	0.791	Q7SXF3_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst1 PE=1 SV=1
2	Q9D1P2	0.0	939	458	0.983	0.983	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
3	Q9H7Z6	0.0	955	458	1.000	1.000	KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2
4	O02193	2.89e-165	488	827	0.511	0.283	MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster OX=7227 GN=mof PE=1 SV=1
5	Q9FLF7	3.34e-141	414	445	0.456	0.470	MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana OX=3702 GN=HAM1 PE=1 SV=1
6	Q9LXD7	1.20e-140	412	445	0.463	0.476	MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana OX=3702 GN=HAM2 PE=1 SV=1
7	E7EUP3	2.57e-115	347	425	0.349	0.376	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
8	O95251	6.50e-115	352	611	0.349	0.262	KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
9	Q5SVQ0	7.41e-115	352	613	0.349	0.261	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1
10	Q960X4	1.42e-112	343	541	0.336	0.285	TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
11	Q7ZW29	4.65e-110	338	568	0.336	0.271	Q7ZW29_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=myst2 PE=1 SV=1
12	B0R0X6	1.01e-107	330	520	0.334	0.294	B0R0X6_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=zgc:92510 PE=1 SV=1
13	Q6DHD0	2.30e-107	330	541	0.334	0.283	Q6DHD0_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=kat5a PE=1 SV=1
14	E9PJI1	4.14e-107	321	302	0.332	0.503	E9PJI1_HUMAN Histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=1
15	Q08649	1.34e-106	325	445	0.362	0.373	ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESA1 PE=1 SV=1
16	Q9TYU5	4.08e-106	324	458	0.373	0.373	TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans OX=6239 GN=mys-1 PE=2 SV=1
17	A0A8C0NLP0	7.64e-106	326	522	0.354	0.310	A0A8C0NLP0_CANLF Histone acetyltransferase OS=Canis lupus familiaris OX=9615 GN=KAT5 PE=1 SV=1
18	Q8CHK4	8.40e-106	325	513	0.354	0.316	KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus OX=10090 GN=Kat5 PE=1 SV=2
19	Q99MK2	8.40e-106	325	513	0.354	0.316	KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus OX=10116 GN=Kat5 PE=1 SV=2
20	Q92993	8.67e-106	325	513	0.354	0.316	KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13508 Acetyltransf_7	15	17.3	Acetyltransferase (GNAT) domain
2	PF08221 HTH_9	2.8e+02	13.0	RNA polymerase III subunit RPC82 helix-turn-helix domain
3	PF01853 MOZ_SAS	2.4e-85	296.2	MOZ/SAS family
4	PF00063 Myosin_head	8.7	16.1	Myosin head (motor domain)
5	PF11717 Tudor-knot	3.1e-17	73.5	RNA binding activity-knot of a chromodomain
6	PF17772 zf-MYST	9.1e-20	81.4	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002043

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007087	0.987	MSL complex subunit 2
2	60711.ENSCSAP00000015274	0.987	Uncharacterized protein
3	60711.ENSCSAP00000011668	0.984	WD repeat domain 5
4	60711.ENSCSAP00000011299	0.982	MSL complex subunit 3
5	60711.ENSCSAP00000000146	0.981	KAT8 regulatory NSL complex subunit 1
6	60711.ENSCSAP00000006361	0.940	PHD finger protein 20
7	60711.ENSCSAP00000002402	0.925	Microspherule protein 1
8	60711.ENSCSAP00000002552	0.922	KAT8 regulatory NSL complex subunit 2
9	60711.ENSCSAP00000013386	0.913	KAT8 regulatory NSL complex subunit 3
10	60711.ENSCSAP00000007551	0.912	Acts as a tumor suppressor in many tumor types
11	60711.ENSCSAP00000004850	0.906	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
12	60711.ENSCSAP00000013789	0.873	Transformation/transcription domain-associated protein
13	60711.ENSCSAP00000018748	0.855	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
14	60711.ENSCSAP00000008730	0.851	DEAH (Asp-Glu-Ala-His) box helicase 9
15	60711.ENSCSAP00000016906	0.848	MYST/Esa1-associated factor 6
16	60711.ENSCSAP00000006164	0.804	KAT8 regulatory NSL complex subunit 1-like
17	60711.ENSCSAP00000000575	0.797	YEATS domain containing 4
18	60711.ENSCSAP00000015277	0.776	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
19	60711.ENSCSAP00000016817	0.776	DNA methyltransferase 1 associated protein 1
20	60711.ENSCSAP00000003094	0.775	Host cell factor C1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010485	1.000	histone H4 acetyltransferase activity
GO:0008134	0.853	transcription factor binding
GO:0140297	0.844	DNA-binding transcription factor binding
GO:0140110	0.529	transcription regulator activity
GO:0097159	0.493	organic cyclic compound binding
GO:1901363	0.491	heterocyclic compound binding
GO:0046972	0.432	histone H4K16 acetyltransferase activity
GO:0003713	0.348	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.986	regulation of biological process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.961	positive regulation of nitrogen compound metabolic process
GO:0031325	0.960	positive regulation of cellular metabolic process
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0007275	0.938	multicellular organism development
GO:0009889	0.937	regulation of biosynthetic process
GO:0031326	0.921	regulation of cellular biosynthetic process
GO:0030154	0.906	cell differentiation
GO:0010556	0.905	regulation of macromolecule biosynthetic process
GO:0048731	0.829	system development
GO:0045935	0.820	positive regulation of nucleobase-containing compound metabolic process
GO:0010468	0.788	regulation of gene expression
GO:0009891	0.785	positive regulation of biosynthetic process
GO:2001141	0.770	regulation of RNA biosynthetic process
GO:0007399	0.767	nervous system development
GO:0006355	0.752	regulation of DNA-templated transcription
GO:0010604	0.741	positive regulation of macromolecule metabolic process
GO:0071704	0.712	organic substance metabolic process
GO:0071840	0.696	cellular component organization or biogenesis
GO:0044238	0.695	primary metabolic process
GO:0016043	0.689	cellular component organization
GO:0031328	0.664	positive regulation of cellular biosynthetic process
GO:0006807	0.650	nitrogen compound metabolic process
GO:0006325	0.648	chromatin organization
GO:0043170	0.630	macromolecule metabolic process
GO:0036211	0.580	protein modification process
GO:0022008	0.562	neurogenesis
GO:0010557	0.503	positive regulation of macromolecule biosynthetic process
GO:0048519	0.487	negative regulation of biological process
GO:0048523	0.472	negative regulation of cellular process
GO:0009892	0.466	negative regulation of metabolic process
GO:0031324	0.462	negative regulation of cellular metabolic process
GO:0010605	0.461	negative regulation of macromolecule metabolic process
GO:0051172	0.458	negative regulation of nitrogen compound metabolic process
GO:0018193	0.443	peptidyl-amino acid modification
GO:0009890	0.421	negative regulation of biosynthetic process
GO:0045934	0.415	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.413	negative regulation of macromolecule biosynthetic process
GO:0051253	0.413	negative regulation of RNA metabolic process
GO:0031327	0.412	negative regulation of cellular biosynthetic process
GO:1903508	0.379	positive regulation of nucleic acid-templated transcription
GO:0045892	0.378	negative regulation of DNA-templated transcription
GO:0045893	0.361	positive regulation of DNA-templated transcription
GO:0016570	0.327	histone modification
GO:0006357	0.326	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005694	0.995	chromosome
GO:0032991	0.992	protein-containing complex
GO:1902494	0.965	catalytic complex
GO:0140513	0.937	nuclear protein-containing complex
GO:0005737	0.794	cytoplasm
GO:1902562	0.635	H4 histone acetyltransferase complex
GO:0044545	0.337	NSL complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]