StarFunc result for job id Q9H808

User Input

>input (572 residues)
MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYS
LHKIQQDVAEHHKQIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSF
EDIMATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDR
QQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRA
SRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRH
VFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVS
VWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGY
PDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMA
NGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVP
EMSPVTCCDVSSNNRLVVTGSGEHASVYQITY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H808	1.000	1.000	0.000	572	1.000	1.000	Q9H808.pdb.gz	TLE6_HUMAN Transducin-like enhancer protein 6 OS=Homo sapiens OX=9606 GN=TLE6 PE=1 SV=2
2	AFDB:Q8MY12	0.438	0.326	5.406E-23	780	0.131	0.096	Q8MY12.pdb.gz	MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum OX=44689 GN=mhkC PE=1 SV=1
3	AFDB:Q676U5	0.453	0.428	1.582E-21	607	0.150	0.142	Q676U5.pdb.gz	A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2
4	AFDB:P16649	0.325	0.266	4.151E-21	713	0.161	0.129	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
5	AFDB:Q6KAU8	0.455	0.420	4.885E-20	623	0.115	0.106	Q6KAU8.pdb.gz	A16L2_MOUSE Protein Atg16l2 OS=Mus musculus OX=10090 GN=Atg16l2 PE=1 SV=2
6	PDB:7jvrB	0.475	0.772	5.020E-20	342	0.096	0.161	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
7	PDB:5mzhB	0.434	0.581	1.249E-19	415	0.096	0.133	5mzhB.pdb.gz
8	AFDB:Q8NAA4	0.448	0.415	1.427E-19	619	0.117	0.108	Q8NAA4.pdb.gz	A16L2_HUMAN Protein Atg16l2 OS=Homo sapiens OX=9606 GN=ATG16L2 PE=1 SV=2
9	PDB:3jcmB	0.479	0.632	2.943E-19	429	0.089	0.119	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
10	PDB:5oa1V	0.476	0.926	2.511E-18	288	0.044	0.087	5oa1V.pdb.gz	Structural insights into transcription initiation by yeast RNA polymerase I.
11	PDB:2h9lA	0.460	0.793	4.291E-18	321	0.087	0.156	2h9lA.pdb.gz
12	PDB:3dm0A	0.463	0.395	1.395E-17	675	0.089	0.076	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
13	PDB:7pzyh	0.455	0.810	1.824E-17	311	0.073	0.135	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	AFDB:Q22071	0.442	0.610	2.875E-17	406	0.096	0.135	Q22071.pdb.gz	MEC15_CAEEL F-box/WD repeat-containing protein mec-15 OS=Caenorhabditis elegans OX=6239 GN=mec-15 PE=1 SV=1
15	PDB:6bk8D	0.463	0.721	2.955E-17	359	0.086	0.136	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
16	PDB:5nnzA	0.435	0.707	3.470E-17	335	0.089	0.152	5nnzA.pdb.gz
17	PDB:5jcsq	0.428	0.496	4.075E-17	488	0.077	0.090	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
18	AFDB:Q9H2Y7	0.435	0.139	2.730E-16	1883	0.115	0.035	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
19	AFDB:Q3U0P1	0.388	0.218	1.438E-15	1104	0.107	0.055	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
20	AFDB:Q5JSH3	0.411	0.266	2.208E-15	913	0.149	0.093	Q5JSH3.pdb.gz	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H808	0.0	1182	572	1.000	1.000	TLE6_HUMAN Transducin-like enhancer protein 6 OS=Homo sapiens OX=9606 GN=TLE6 PE=1 SV=2
2	Q9WVB3	9.19e-141	422	581	0.402	0.396	TLE6_MOUSE Transducin-like enhancer protein 6 OS=Mus musculus OX=10090 GN=Tle6 PE=1 SV=1
3	K7EMK7	6.20e-62	219	744	0.199	0.153	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
4	Q04725	6.83e-62	219	743	0.199	0.153	TLE2_HUMAN Transducin-like enhancer protein 2 OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=2
5	Q8JIM6	1.56e-57	207	773	0.189	0.140	Q8JIM6_CHICK Groucho-related gene 4 OS=Gallus gallus OX=9031 GN=Grg4 PE=2 SV=1
6	O42478	1.60e-57	207	772	0.189	0.140	TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis OX=8355 GN=tle4 PE=1 SV=2
7	Q04727	1.70e-57	207	773	0.189	0.140	TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3
8	Q62441	1.81e-57	207	773	0.189	0.140	TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus OX=10090 GN=Tle4 PE=1 SV=4
9	Q07141	1.94e-57	207	748	0.189	0.144	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
10	P16371	4.90e-56	203	730	0.184	0.144	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
11	O13166	9.53e-56	202	761	0.184	0.138	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
12	H0YNT2	1.22e-55	201	716	0.182	0.145	H0YNT2_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
13	Q9JIT3	1.34e-55	202	764	0.182	0.136	TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1
14	Q04726	1.71e-55	202	772	0.182	0.135	TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2
15	Q08122	1.89e-55	202	772	0.182	0.135	TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus OX=10090 GN=Tle3 PE=1 SV=3
16	H0YKT5	2.13e-55	201	774	0.182	0.134	H0YKT5_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
17	H0YKN8	2.29e-55	201	778	0.182	0.134	H0YKN8_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
18	H0YL70	2.46e-55	201	782	0.182	0.133	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
19	Q62440	3.85e-55	201	770	0.185	0.138	TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus OX=10090 GN=Tle1 PE=1 SV=2
20	Q04724	4.60e-55	201	770	0.185	0.138	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00400 WD40	0.0017	30.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246112

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359384	0.975	Oocyte-expressed protein homolog
2	9606.ENSP00000359392	0.898	KHDC3-like protein
3	9606.ENSP00000375063	0.841	NACHT, LRR and PYD domains-containing protein 5
4	9606.ENSP00000483125	0.790	Protein-arginine deiminase type-6
5	9606.ENSP00000226067	0.733	Hepatic leukemia factor
6	9606.ENSP00000221561	0.681	Amino-terminal enhancer of split
7	9606.ENSP00000262965	0.668	Transcription factor E2-alpha
8	9606.ENSP00000362095	0.650	Sushi repeat-containing protein SRPX2
9	9606.ENSP00000351206	0.647	Beta-taxilin
10	9606.ENSP00000478026	0.642	Annexin A8
11	9606.ENSP00000252597	0.635	Usher syndrome type-1C protein-binding protein 1
12	9606.ENSP00000339004	0.602	Forkhead box protein G1
13	9606.ENSP00000381032	0.585	Nucleoplasmin-2
14	9606.ENSP00000375639	0.576	TCF3 fusion partner
15	9606.ENSP00000407118	0.562	Syntabulin
16	9606.ENSP00000266304	0.554	Thyrotroph embryonic factor
17	9606.ENSP00000222122	0.552	D site-binding protein
18	9606.ENSP00000249014	0.552	Cdc42 effector protein 1
19	9606.ENSP00000380602	0.546	Contactin-4
20	9606.ENSP00000356641	0.545	E3 ubiquitin-protein ligase RFWD2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.941	anatomical structure development
GO:0032501	0.938	multicellular organismal process
GO:0007275	0.896	multicellular organism development
GO:0044706	0.857	multi-multicellular organism process
GO:0044703	0.851	multi-organism reproductive process
GO:0050794	0.798	regulation of cellular process
GO:0009987	0.765	cellular process
GO:0009790	0.700	embryo development
GO:0009792	0.665	embryo development ending in birth or egg hatching
GO:0048609	0.532	multicellular organismal reproductive process
GO:0048518	0.483	positive regulation of biological process
GO:0019222	0.479	regulation of metabolic process
GO:0031323	0.462	regulation of cellular metabolic process
GO:0007565	0.461	female pregnancy
GO:0060255	0.426	regulation of macromolecule metabolic process
GO:0080090	0.425	regulation of primary metabolic process
GO:0051171	0.423	regulation of nitrogen compound metabolic process
GO:0019219	0.350	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.333	regulation of gene expression
GO:0048522	0.319	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0043227	0.956	membrane-bounded organelle
GO:0043231	0.927	intracellular membrane-bounded organelle
GO:0005634	0.834	nucleus
GO:0071944	0.437	cell periphery
GO:0012505	0.383	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]