StarFunc result for job id Q9H814

User Input

>input (394 residues)
MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAV
ESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGA
VLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMH
GGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQE
PKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSIS
EEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNE
ALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H814	1.000	1.000	9.997E-58	394	1.000	1.000	Q9H814.pdb.gz	PHAX_HUMAN Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1
2	AFDB:A2BEV6	0.105	0.052	1.622E-2	861	0.155	0.071	A2BEV6.pdb.gz	A2BEV6_DANRE Nexilin OS=Danio rerio OX=7955 GN=CH211-232D19.9 PE=4 SV=2
3	AFDB:A3KGV1	0.143	0.075	3.314E-2	830	0.129	0.061	A3KGV1.pdb.gz	ODFP2_MOUSE Outer dense fiber protein 2 OS=Mus musculus OX=10090 GN=Odf2 PE=1 SV=1
4	AFDB:Q4G5U8	0.103	0.057	3.314E-2	780	0.162	0.082	Q4G5U8.pdb.gz
5	AFDB:Q8GXC2	0.078	0.078	4.464E-2	397	0.142	0.141	Q8GXC2.pdb.gz	PHL4_ARATH Myb family transcription factor PHL4 OS=Arabidopsis thaliana OX=3702 GN=PHL4 PE=2 SV=1
6	AFDB:Q8N6Y0	0.121	0.078	4.738E-2	703	0.168	0.094	Q8N6Y0.pdb.gz	USBP1_HUMAN Harmonin-binding protein USHBP1 OS=Homo sapiens OX=9606 GN=USHBP1 PE=1 SV=1
7	AFDB:Q8TD10	0.099	0.091	5.337E-2	442	0.119	0.106	Q8TD10.pdb.gz	MIPO1_HUMAN Mirror-image polydactyly gene 1 protein OS=Homo sapiens OX=9606 GN=MIPOL1 PE=1 SV=1
8	AFDB:Q8C9S4	0.101	0.048	6.012E-2	917	0.150	0.064	Q8C9S4.pdb.gz	CC186_MOUSE Coiled-coil domain-containing protein 186 OS=Mus musculus OX=10090 GN=Ccdc186 PE=1 SV=2
9	AFDB:Q20010	0.092	0.090	7.188E-2	404	0.127	0.124	Q20010.pdb.gz	SAS5_CAEEL Spindle assembly abnormal protein 5 OS=Caenorhabditis elegans OX=6239 GN=sas-5 PE=1 SV=2
10	AFDB:P32380	0.112	0.051	8.097E-2	944	0.180	0.075	P32380.pdb.gz	SP110_YEAST Spindle pole body component 110 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC110 PE=1 SV=1
11	PDB:5n9jE	0.107	0.184	2.000	201	0.071	0.139	5n9jE.pdb.gz
12	PDB:6igmC	0.106	0.112	2.253	370	0.020	0.022	6igmC.pdb.gz
13	PDB:5yzgL	0.102	0.097	3.035	419	0.094	0.088	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:7msnA	0.125	0.120	3.418	417	0.038	0.036	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
15	PDB:6f40W	0.103	0.179	5.186	218	0.071	0.128	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
16	PDB:7c79B	0.074	0.042	5.504	793	0.038	0.019	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
17	PDB:7mqaNA	0.078	0.097	5.842	295	0.099	0.132	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7dyrY	0.107	0.145	6.200	248	0.051	0.081	7dyrY.pdb.gz	Structure of the mannose phosphotransferase system (man-PTS) complexed with microcin E492, a pore-forming bacteriocin.
19	PDB:4v8mAG	0.075	0.153	6.581	141	0.056	0.156	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:6gejT	0.110	0.100	6.581	443	0.028	0.025	6gejT.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63068	0.0	654	385	0.858	0.878	PHAX_RAT Phosphorylated adapter RNA export protein OS=Rattus norvegicus OX=10116 GN=Phax PE=1 SV=2
2	Q9H814	0.0	816	394	1.000	1.000	PHAX_HUMAN Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1
3	Q9JJT9	0.0	681	385	0.858	0.878	PHAX_MOUSE Phosphorylated adapter RNA export protein OS=Mus musculus OX=10090 GN=Phax PE=1 SV=1
4	Q9UPU9	2.0	33.1	718	0.109	0.060	SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=3
5	A7BJ65	7.3	31.6	937	0.061	0.026	A7BJ65_BOMMO BmRelish1 OS=Bombyx mori OX=7091 GN=100124425 PE=2 SV=1
6	Q06836	8.1	31.2	1226	0.081	0.026	SYT1_YEAST Arf guanine nucleotide exchange factor SYT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10258 PHAX_RNA-bd	3.6e-30	115.1	Phosphorylated adapter RNA export protein, RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480421	0.995	Serrate RNA effector molecule homolog
2	9606.ENSP00000326806	0.992	Nuclear cap-binding protein subunit 2
3	9606.ENSP00000384863	0.987	Exportin-1
4	9606.ENSP00000364289	0.978	Nuclear cap-binding protein subunit 1
5	9606.ENSP00000379182	0.934	mRNA export factor
6	9606.ENSP00000352400	0.929	Nuclear pore complex protein Nup214
7	9606.ENSP00000458954	0.917	Nuclear pore complex protein Nup88
8	9606.ENSP00000283195	0.914	E3 SUMO-protein ligase RanBP2
9	9606.ENSP00000345895	0.911	Nuclear pore complex protein Nup50
10	9606.ENSP00000258742	0.909	Nucleoporin-like protein 2
11	9606.ENSP00000371155	0.908	Nucleoporin p58/p45
12	9606.ENSP00000471191	0.908	Nuclear pore glycoprotein p62
13	9606.ENSP00000231498	0.907	Nuclear pore complex protein Nup155
14	9606.ENSP00000444029	0.906	Nuclear pore complex protein Nup153
15	9606.ENSP00000295119	0.905	Nucleoporin NUP53
16	9606.ENSP00000316032	0.904	Nuclear pore complex protein Nup98-Nup96
17	9606.ENSP00000342262	0.904	Nucleoporin Nup43
18	9606.ENSP00000356448	0.904	Nucleoprotein TPR
19	9606.ENSP00000481575	0.904	Nuclear envelope pore membrane protein POM 121C
20	9606.ENSP00000358716	0.903	Probable ATP-dependent RNA helicase DDX20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0140262	0.981	mRNA cap binding complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.947	biological regulation
GO:0050789	0.941	regulation of biological process
GO:0050794	0.900	regulation of cellular process
GO:0051641	0.866	cellular localization
GO:0051234	0.865	establishment of localization
GO:0051649	0.860	establishment of localization in cell
GO:0051171	0.858	regulation of nitrogen compound metabolic process
GO:0010468	0.858	regulation of gene expression
GO:0080090	0.852	regulation of primary metabolic process
GO:0031323	0.851	regulation of cellular metabolic process
GO:0006810	0.842	transport
GO:0046907	0.802	intracellular transport
GO:0033036	0.798	macromolecule localization
GO:0006913	0.775	nucleocytoplasmic transport
GO:0006405	0.751	RNA export from nucleus
GO:0048519	0.727	negative regulation of biological process
GO:0019219	0.712	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.609	regulation of RNA metabolic process
GO:0048523	0.605	negative regulation of cellular process
GO:0071704	0.417	organic substance metabolic process
GO:0010605	0.355	negative regulation of macromolecule metabolic process
GO:0043170	0.339	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.998	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:1990904	0.962	ribonucleoprotein complex
GO:0005856	0.733	cytoskeleton
GO:0015630	0.694	microtubule cytoskeleton
GO:0005815	0.559	microtubule organizing center
GO:0005813	0.524	centrosome
GO:0140513	0.390	nuclear protein-containing complex
GO:0012505	0.313	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]