StarFunc result for job id Q9H819

User Input

>input (358 residues)
MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCMKAQKEKKSENEWTQTRQG
EGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGAT
DAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTAPRARPYNYYRDFEADITPEELFNVFF
GGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVI
ISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIE
KDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBM8	0.507	0.483	6.504E-31	379	0.450	0.425	Q8TBM8.pdb.gz	DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14 PE=1 SV=1
2	AFDB:J3KPS0	0.430	0.383	1.494E-27	409	0.383	0.335	J3KPS0.pdb.gz	J3KPS0_HUMAN DnaJ (Hsp40) homolog, subfamily B, member 12, isoform CRA_c OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
3	AFDB:Q17438	0.393	0.355	2.090E-22	401	0.358	0.319	Q17438.pdb.gz	DNJ1_CAEEL DnaJ homolog subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=dnj-1 PE=1 SV=1
4	AFDB:Q9VFP0	0.346	0.336	4.908E-22	370	0.318	0.308	Q9VFP0.pdb.gz	Q9VFP0_DROME RH07106p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3061 PE=1 SV=1
5	AFDB:O13633	0.289	0.258	1.937E-19	403	0.288	0.256	O13633.pdb.gz	YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi041 PE=1 SV=1
6	AFDB:Q9FH28	0.301	0.304	1.689E-15	354	0.251	0.254	Q9FH28.pdb.gz	DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana OX=3702 GN=ATJ49 PE=2 SV=2
7	AFDB:O96123	0.211	0.180	3.356E-7	421	0.145	0.124	O96123.pdb.gz	O96123_PLAF7 Knob associated heat shock protein 40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201800 PE=4 SV=3
8	AFDB:P48353	0.234	0.370	3.356E-7	224	0.165	0.263	P48353.pdb.gz	HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HLJ1 PE=1 SV=1
9	AFDB:Q24133	0.236	0.251	4.382E-7	334	0.148	0.159	Q24133.pdb.gz	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
10	AFDB:D3ZUU5	0.240	0.233	7.473E-7	371	0.131	0.127	D3ZUU5.pdb.gz	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
11	PDB:6byrA	0.181	0.161	3.361E-4	405	0.103	0.091	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.185	0.246	3.139E-2	262	0.089	0.122	7x3kA.pdb.gz
13	PDB:7mq8LT	0.143	0.073	1.388	869	0.042	0.017	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:2gbbA	0.085	0.149	1.545	156	0.036	0.083	2gbbA.pdb.gz
15	PDB:5apnh	0.123	0.327	1.629	119	0.064	0.193	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:4v6wCh	0.124	0.301	1.719	123	0.039	0.114	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:5xjt2	0.064	0.090	1.719	217	0.047	0.078	5xjt2.pdb.gz	Structures of 7S mutant complexes
18	PDB:6gg1A	0.117	0.232	1.912	145	0.036	0.090	6gg1A.pdb.gz
19	PDB:6ahd1	0.096	0.039	2.245	1048	0.064	0.022	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
20	PDB:6yxyBA	0.125	0.064	2.634	769	0.070	0.033	6yxyBA.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBM8	1.00e-114	340	379	0.453	0.427	DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14 PE=1 SV=1
2	Q9NXW2	7.08e-93	284	375	0.385	0.368	DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=5
3	J3KPS0	1.66e-92	284	409	0.385	0.337	J3KPS0_HUMAN DnaJ (Hsp40) homolog, subfamily B, member 12, isoform CRA_c OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
4	V9GYN7	2.54e-89	271	276	0.352	0.457	V9GYN7_HUMAN DnaJ heat shock protein family (Hsp40) member B12 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
5	Q17438	1.66e-66	217	401	0.360	0.322	DNJ1_CAEEL DnaJ homolog subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=dnj-1 PE=1 SV=1
6	Q9VFP0	6.61e-65	212	370	0.304	0.295	Q9VFP0_DROME RH07106p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3061 PE=1 SV=1
7	O13633	6.30e-37	139	403	0.288	0.256	YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi041 PE=1 SV=1
8	V9GY70	1.93e-34	126	172	0.162	0.337	V9GY70_HUMAN DnaJ heat shock protein family (Hsp40) member B12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
9	Q9FH28	3.04e-24	103	354	0.235	0.237	DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana OX=3702 GN=ATJ49 PE=2 SV=2
10	Q7KQK3	9.55e-21	92.0	244	0.145	0.213	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
11	Q7ZVY8	6.68e-20	91.3	337	0.137	0.145	Q7ZVY8_DANRE DnaJ homolog subfamily B member 1 OS=Danio rerio OX=7955 GN=zgc:55492 PE=1 SV=1
12	C9JUL4	1.52e-19	87.0	172	0.131	0.273	C9JUL4_HUMAN DnaJ heat shock protein family (Hsp40) member B4 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
13	Q6DEJ4	2.50e-19	89.7	335	0.140	0.149	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
14	Q20774	5.24e-19	89.0	331	0.131	0.142	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
15	Q9UDY4	9.47e-19	88.2	337	0.134	0.142	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
16	O89114	1.18e-18	88.2	348	0.131	0.135	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1
17	Q585V4	1.55e-18	88.2	404	0.126	0.111	Q585V4_TRYB2 Chaperone protein DnaJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.30 PE=3 SV=1
18	Q24133	1.98e-18	87.0	334	0.151	0.162	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
19	O75953	2.19e-18	87.4	348	0.131	0.135	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
20	M0QXK0	2.55e-18	85.9	273	0.134	0.176	M0QXK0_HUMAN DnaJ heat shock protein family (Hsp40) member B1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	3.3e-21	86.5	DnaJ domain
2	PF09320 DUF1977	1.5e-21	87.9	Domain of unknown function (DUF1977)
3	PF02447 GntP_permease	56	13.9	GntP family permease
4	PF06423 GWT1	5.9e+02	11.9	GWT1
5	PF13446 RPT	4.4e+02	12.2	A repeated domain in UCH-protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263697	0.860	DnaJ homolog subfamily C member 8
2	9606.ENSP00000297185	0.807	Stress-70 protein, mitochondrial
3	9606.ENSP00000458018	0.743	Heat shock protein family B member 9
4	9606.ENSP00000414920	0.737	Spermatogenesis-associated protein 24
5	9606.ENSP00000373594	0.726	Transmembrane protein 266
6	9606.ENSP00000318687	0.715	Heat shock protein 105 kDa
7	9606.ENSP00000296464	0.684	Heat shock 70 kDa protein 4L
8	9606.ENSP00000247843	0.683	YEATS domain-containing protein 4
9	9606.ENSP00000378294	0.681	Nucleotide exchange factor SIL1
10	9606.ENSP00000274711	0.667	Leucine-rich repeat transmembrane neuronal protein 2
11	9606.ENSP00000221566	0.659	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
12	9606.ENSP00000261735	0.647	Endoplasmic reticulum resident protein 29
13	9606.ENSP00000432083	0.640	Heat shock cognate 71 kDa protein
14	9606.ENSP00000302961	0.636	Heat shock protein family A member 4
15	9606.ENSP00000338165	0.634	Transmembrane protein 39B
16	9606.ENSP00000216214	0.628	Protein FAM118A
17	9606.ENSP00000324173	0.608	78 kDa glucose-regulated protein
18	9606.ENSP00000369291	0.605	LETM1 domain-containing protein LETM2, mitochondrial
19	9606.ENSP00000367623	0.604	Heat shock 70 kDa protein 14
20	9606.ENSP00000378199	0.599	Heat shock-related 70 kDa protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031072	0.725	heat shock protein binding
GO:0030544	0.570	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071840	0.948	cellular component organization or biogenesis
GO:0016043	0.888	cellular component organization
GO:0043933	0.679	protein-containing complex organization
GO:0065003	0.672	protein-containing complex assembly
GO:0006457	0.575	protein folding
GO:0050896	0.472	response to stimulus
GO:0065007	0.420	biological regulation
GO:0050789	0.402	regulation of biological process
GO:0006950	0.382	response to stress
GO:0050794	0.354	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0005634	0.990	nucleus
GO:0005783	0.990	endoplasmic reticulum
GO:0031090	0.985	organelle membrane
GO:0005829	0.729	cytosol
GO:0042175	0.514	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.476	organelle subcompartment
GO:0098827	0.457	endoplasmic reticulum subcompartment
GO:0005635	0.426	nuclear envelope
GO:0005789	0.420	endoplasmic reticulum membrane
GO:0031965	0.318	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]