StarFunc result for job id Q9H825

User Input

>input (291 residues)
MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAA
ARKKVKENSAVRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQK
PEEKARESSWDHVKTSATNRFSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEK
HKKGPMETGLFPGSNATFRILEVGCGAGNSVFPILNTLENSPESFLYCCDFASGAVELVK
SHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVLSSIHPDRTLFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H825	1.000	1.000	2.170E-54	291	1.000	1.000	Q9H825.pdb.gz	METL8_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial OS=Homo sapiens OX=9606 GN=METTL8 PE=1 SV=2
2	AFDB:A2AUU0	0.758	0.784	4.007E-40	281	0.708	0.733	A2AUU0.pdb.gz	METL8_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial OS=Mus musculus OX=10090 GN=Mettl8 PE=1 SV=2
3	AFDB:Q8BMK1	0.593	0.452	1.161E-24	389	0.412	0.308	Q8BMK1.pdb.gz	METL2_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL2 OS=Mus musculus OX=10090 GN=Mettl2 PE=1 SV=2
4	AFDB:Q6P1Q9	0.586	0.458	3.920E-24	378	0.440	0.339	Q6P1Q9.pdb.gz	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3
5	PDB:7ezgA	0.447	0.471	1.984E-8	275	0.223	0.236	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
6	PDB:3g5tA	0.184	0.179	9.939E-4	299	0.038	0.037	3g5tA.pdb.gz	Crystal structure of trans-aconitate 3-methyltransferase from yeast
7	PDB:4hh4C	0.180	0.203	1.130E-3	256	0.034	0.039	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
8	PDB:3lccA	0.193	0.254	2.436E-3	216	0.072	0.097	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
9	PDB:7bggA	0.254	0.336	2.436E-3	216	0.069	0.093	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
10	PDB:4a6dA	0.183	0.156	3.355E-3	345	0.058	0.049	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
11	PDB:4f86A	0.196	0.206	3.814E-3	275	0.038	0.040	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation
12	PDB:5wp4A	0.265	0.162	4.066E-3	485	0.065	0.039	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
13	PDB:4iwnA	0.257	0.321	4.335E-3	229	0.052	0.066	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
14	PDB:5wp5A	0.218	0.141	4.621E-3	463	0.058	0.037	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
15	AFDB:P21218	0.167	0.126	2.334E-2	401	0.065	0.047	P21218.pdb.gz	PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PORB PE=1 SV=3
16	AFDB:Q9SN86	0.145	0.110	2.334E-2	403	0.086	0.062	Q9SN86.pdb.gz	MDHP_ARATH Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g47520 PE=1 SV=1
17	AFDB:P13653	0.162	0.127	2.653E-2	388	0.069	0.052	P13653.pdb.gz	PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare OX=4513 GN=PORA PE=1 SV=1
18	AFDB:O53493	0.165	0.061	3.654E-2	874	0.069	0.023	O53493.pdb.gz	PPMNT_MYCTU Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppm1 PE=1 SV=1
19	AFDB:Q42850	0.168	0.128	4.720E-2	395	0.058	0.043	Q42850.pdb.gz	PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare OX=4513 GN=PORB PE=1 SV=1
20	AFDB:Q5QM25	0.149	0.109	7.390E-2	446	0.110	0.072	Q5QM25.pdb.gz	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H825	0.0	610	291	1.000	1.000	METL8_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial OS=Homo sapiens OX=9606 GN=METTL8 PE=1 SV=2
2	A2AUU0	1.25e-137	391	281	0.704	0.730	METL8_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial OS=Mus musculus OX=10090 GN=Mettl8 PE=1 SV=2
3	Q6P1Q9	8.61e-77	240	378	0.436	0.336	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3
4	Q96IZ6	2.83e-76	239	378	0.433	0.333	MET2A_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5
5	Q8BMK1	1.50e-74	235	389	0.409	0.306	METL2_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL2 OS=Mus musculus OX=10090 GN=Mettl2 PE=1 SV=2
6	Q8TCB7	9.08e-17	80.5	284	0.131	0.134	METL6_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL6 OS=Homo sapiens OX=9606 GN=METTL6 PE=1 SV=2
7	O74386	2.49e-16	79.0	248	0.131	0.153	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
8	Q8BVH9	3.71e-15	75.9	282	0.127	0.131	METL6_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL6 OS=Mus musculus OX=10090 GN=Mettl6 PE=1 SV=2
9	Q9P7L6	1.30e-14	74.7	307	0.151	0.143	TR140_SCHPO tRNA N(3)-methylcytidine methyltransferase trm140 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm140 PE=1 SV=2
10	Q08641	2.06e-13	72.4	628	0.117	0.054	AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABP140 PE=1 SV=3
11	Q38DL9	0.024	38.1	316	0.093	0.085	Q38DL9_TRYB2 tRNA N(3)-methylcytidine methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2860 PE=3 SV=1
12	Q54818	0.055	37.0	286	0.065	0.066	DNRC_STRPE Aklanonic acid methyltransferase DnrC OS=Streptomyces peucetius OX=1950 GN=dnrC PE=1 SV=1
13	P0DO30	0.23	35.8	4036	0.107	0.008	ILIA_NEOS2 Hybrid PKS-NRPS synthetase iliA OS=Neonectria sp. (strain DH2) OX=1735992 GN=iliA PE=1 SV=1
14	W7LKX1	0.68	34.3	2586	0.100	0.011	FUM1_GIBM7 Highly reducing polyketide synthase FUM1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM1 PE=2 SV=1
15	A5HAK1	0.69	32.7	150	0.086	0.167	A5HAK1_DANRE RNase 2 OS=Danio rerio OX=7955 GN=si:ch211-139g14.6 PE=2 SV=1
16	Q3ED65	0.99	33.1	261	0.058	0.065	MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MENG PE=1 SV=2
17	Q5BA83	1.1	33.5	2534	0.093	0.011	EASB_EMENI Highly reducing polyketide synthase easB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=easB PE=3 SV=1
18	Q55214	1.7	32.3	220	0.065	0.086	DNRC_STRS5 Aklanonic acid methyltransferase DauC OS=Streptomyces sp. (strain C5) OX=45212 GN=dauC PE=1 SV=1
19	Q8N6F8	1.8	32.3	245	0.089	0.106	MET27_HUMAN Methyltransferase-like protein 27 OS=Homo sapiens OX=9606 GN=METTL27 PE=1 SV=2
20	W5U2K2	2.2	32.0	289	0.089	0.090	NMT_CATRO 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase OS=Catharanthus roseus OX=4058 GN=NMT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	0.038	26.0	Methyltransferase domain
2	PF08242 Methyltransf_12	0.0089	28.1	Methyltransferase domain
3	PF13489 Methyltransf_23	1.2e+02	13.9	Methyltransferase domain
4	PF13649 Methyltransf_25	0.00017	33.5	Methyltransferase domain
5	PF02636 Methyltransf_28	9.2e+02	10.8	Putative S-adenosyl-L-methionine-dependent methyltransferase
6	PF13847 Methyltransf_31	5.8e+02	11.7	Methyltransferase domain
7	PF05175 MTS	6.1e+02	11.4	Methyltransferase small domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225525	0.820	Tax1-binding protein 3
2	9606.ENSP00000248306	0.788	Methyltransferase-like protein 25
3	9606.ENSP00000344071	0.788	Methyltransferase-like protein 24
4	9606.ENSP00000263092	0.747	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
5	9606.ENSP00000350874	0.725	Methyltransferase-like protein 9
6	9606.ENSP00000357829	0.711	EEF1A lysine methyltransferase 2
7	9606.ENSP00000267273	0.637	Protein-lysine methyltransferase METTL21C
8	9606.ENSP00000354920	0.622	Methyltransferase-like protein 13
9	9606.ENSP00000376753	0.611	PDZ domain-containing protein GIPC1
10	9606.ENSP00000318986	0.563	tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
11	9606.ENSP00000245838	0.553	THO complex subunit 2
12	9606.ENSP00000203001	0.544	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
13	9606.ENSP00000377796	0.533	Methyltransferase-like protein 7B
14	9606.ENSP00000362550	0.517	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
15	9606.ENSP00000359222	0.510	Transmembrane protein 56
16	9606.ENSP00000298717	0.507	N6-adenosine-methyltransferase catalytic subunit
17	9606.ENSP00000448785	0.505	Methyltransferase-like protein 7A
18	9606.ENSP00000263556	0.502	Prolyl 4-hydroxylase subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008174	1.000	mRNA methyltransferase activity
GO:0052735	1.000	tRNA (cytosine-3-)-methyltransferase activity
GO:0005488	0.629	binding
GO:0005515	0.530	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0016071	0.974	mRNA metabolic process
GO:0034660	0.969	ncRNA metabolic process
GO:0006399	0.963	tRNA metabolic process
GO:0034470	0.963	ncRNA processing
GO:0008033	0.952	tRNA processing
GO:0031323	0.950	regulation of cellular metabolic process
GO:0016556	0.949	mRNA modification
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0010468	0.945	regulation of gene expression
GO:0010608	0.936	post-transcriptional regulation of gene expression
GO:0031326	0.932	regulation of cellular biosynthetic process
GO:0006400	0.913	tRNA modification
GO:0044260	0.871	cellular macromolecule metabolic process
GO:0006417	0.865	regulation of translation
GO:0030488	0.852	tRNA methylation
GO:0034250	0.816	positive regulation of amide metabolic process
GO:0062125	0.806	regulation of mitochondrial gene expression
GO:0045727	0.790	positive regulation of translation
GO:0070129	0.636	regulation of mitochondrial translation
GO:0080009	0.339	mRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.854	mitochondrion
GO:0005634	0.746	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]