StarFunc result for job id Q9H832

User Input

>input (354 residues)
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UE37	0.836	0.831	1.896E-60	356	0.994	0.989	Q3UE37.pdb.gz	UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus OX=10090 GN=Ube2z PE=1 SV=2
2	PDB:5a4pA	0.636	0.990	2.284E-42	227	0.638	0.996	5a4pA.pdb.gz
3	AFDB:Q8VY10	0.550	0.225	6.279E-16	907	0.218	0.085	Q8VY10.pdb.gz	UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 24 OS=Arabidopsis thaliana OX=3702 GN=UBC24 PE=1 SV=1
4	AFDB:Q9C0C9	0.459	0.140	2.234E-13	1292	0.186	0.051	Q9C0C9.pdb.gz	UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3
5	AFDB:Q54F00	0.362	0.435	5.027E-12	292	0.164	0.199	Q54F00.pdb.gz	Q54F00_DICDI UBC core domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291199 PE=3 SV=1
6	AFDB:F4JKF3	0.355	0.690	1.365E-11	178	0.158	0.315	F4JKF3.pdb.gz	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
7	AFDB:P51965	0.354	0.634	1.726E-11	193	0.141	0.259	P51965.pdb.gz	UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 PE=1 SV=1
8	AFDB:P52485	0.357	0.535	1.726E-11	232	0.175	0.267	P52485.pdb.gz	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1
9	AFDB:Q8I607	0.350	0.818	1.726E-11	147	0.138	0.333	Q8I607.pdb.gz	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
10	AFDB:P52483	0.356	0.596	1.831E-11	207	0.153	0.261	P52483.pdb.gz	UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus OX=10090 GN=Ube2e3 PE=1 SV=2
11	AFDB:Q9I7T6	0.396	0.396	2.184E-11	354	0.195	0.195	Q9I7T6.pdb.gz	Q9I7T6_DROME FI16911p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10862 PE=2 SV=1
12	PDB:7un3A	0.501	0.287	2.558E-11	649	0.178	0.097	7un3A.pdb.gz
13	PDB:4ccgA	0.356	0.768	4.340E-11	157	0.141	0.318	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
14	PDB:6cyrA	0.358	0.773	4.603E-11	153	0.138	0.320	6cyrA.pdb.gz
15	PDB:3ptfA	0.358	0.799	6.548E-11	153	0.138	0.320	3ptfA.pdb.gz
16	PDB:2aakA	0.368	0.834	6.944E-11	150	0.136	0.320	2aakA.pdb.gz
17	PDB:4ii2C	0.358	0.813	7.810E-11	149	0.150	0.356	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
18	PDB:5aieB	0.363	0.825	9.879E-11	150	0.141	0.333	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:2cyxA	0.373	0.743	1.250E-10	169	0.121	0.254	2cyxA.pdb.gz
20	PDB:3e46A	0.374	0.634	1.778E-10	202	0.141	0.248	3e46A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UE37	0.0	726	356	0.994	0.989	UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus OX=10090 GN=Ube2z PE=1 SV=2
2	Q9H832	0.0	733	354	1.000	1.000	UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z PE=1 SV=2
3	O88738	5.13e-31	126	4882	0.203	0.015	BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Birc6 PE=1 SV=2
4	Q9NR09	5.37e-31	126	4857	0.203	0.015	BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=3
5	Q9VH01	1.10e-30	125	4876	0.215	0.016	Q9VH01_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform A OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=3
6	A0A0B4KH36	1.11e-30	125	4852	0.215	0.016	A0A0B4KH36_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform C OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
7	A0A0B4KGR9	1.12e-30	125	4875	0.215	0.016	A0A0B4KGR9_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform D OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
8	A0A0B4KFQ0	1.14e-30	125	4865	0.215	0.016	A0A0B4KFQ0_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform E OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
9	A0A0B4KG50	1.32e-30	125	4976	0.215	0.015	A0A0B4KG50_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform B OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
10	Q6ZPJ3	2.45e-22	100	1288	0.167	0.046	UBE2O_MOUSE (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O OS=Mus musculus OX=10090 GN=Ube2o PE=1 SV=3
11	Q9C0C9	2.82e-22	100	1292	0.167	0.046	UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3
12	Q8S920	7.58e-22	92.4	147	0.167	0.401	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
13	Q8S919	7.63e-22	92.4	148	0.164	0.392	UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5B PE=2 SV=1
14	P35131	4.66e-21	90.1	148	0.161	0.385	UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana OX=3702 GN=UBC8 PE=1 SV=1
15	P35133	5.78e-21	90.1	148	0.161	0.385	UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana OX=3702 GN=UBC10 PE=1 SV=1
16	Q84K93	7.69e-21	89.7	148	0.164	0.392	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1
17	P35128	1.15e-20	89.4	151	0.119	0.278	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
18	F4JKF3	1.31e-20	89.7	178	0.164	0.326	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
19	A5PKP9	2.16e-20	88.6	147	0.150	0.361	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
20	Q84K64	2.36e-20	88.2	148	0.144	0.345	Q84K64_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	2.8e+02	13.2	RWD domain
2	PF05743 UEV	1.6	20.0	UEV domain
3	PF08694 UFC1	5.7e+02	11.6	Ubiquitin-fold modifier-conjugating enzyme 1
4	PF00179 UQ_con	4.4e-26	102.6	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313454	0.997	Ubiquitin-like modifier-activating enzyme 6
2	9606.ENSP00000338413	0.980	Ubiquitin-like modifier-activating enzyme 1
3	9606.ENSP00000360116	0.976	Ubiquitin-conjugating enzyme E2 U
4	9606.ENSP00000292211	0.959	Ubiquitin-conjugating enzyme E2 Q1
5	9606.ENSP00000267938	0.953	Ubiquitin-conjugating enzyme E2 Q2
6	9606.ENSP00000347836	0.950	Ubiquitin-conjugating enzyme E2 H
7	9606.ENSP00000333266	0.949	Ubiquitin-like modifier-activating enzyme 7
8	9606.ENSP00000340305	0.946	Ubiquitin-conjugating enzyme E2 variant 1
9	9606.ENSP00000428209	0.944	Ubiquitin-conjugating enzyme E2 variant 2
10	9606.ENSP00000354340	0.939	NEDD8-activating enzyme E1 catalytic subunit
11	9606.ENSP00000348565	0.927	Ubiquitin-like modifier-activating enzyme 5
12	9606.ENSP00000386788	0.923	Ubiquitin-conjugating enzyme E2 E3
13	9606.ENSP00000303709	0.922	Ubiquitin-conjugating enzyme E2 E1
14	9606.ENSP00000346437	0.921	Ubiquitin-like modifier-activating enzyme ATG7
15	9606.ENSP00000263228	0.920	Ubiquitin-conjugating enzyme E2 R2
16	9606.ENSP00000383719	0.920	Ubiquitin-conjugating enzyme E2 J2
17	9606.ENSP00000261427	0.918	Ubiquitin-conjugating enzyme E2 K
18	9606.ENSP00000264552	0.918	Ubiquitin-conjugating enzyme E2 S
19	9606.ENSP00000397453	0.918	Ubiquitin-conjugating enzyme E2 W
20	9606.ENSP00000451261	0.918	Ubiquitin-conjugating enzyme E2 J1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061650	1.000	ubiquitin-like protein conjugating enzyme activity
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0005515	0.999	protein binding
GO:0061631	0.990	ubiquitin conjugating enzyme activity
GO:0060090	0.752	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0019538	0.990	protein metabolic process
GO:0043632	0.977	modification-dependent macromolecule catabolic process
GO:0006508	0.973	proteolysis
GO:0050794	0.956	regulation of cellular process
GO:1901565	0.941	organonitrogen compound catabolic process
GO:0051603	0.921	proteolysis involved in protein catabolic process
GO:0006511	0.896	ubiquitin-dependent protein catabolic process
GO:0048518	0.814	positive regulation of biological process
GO:0048522	0.780	positive regulation of cellular process
GO:0043412	0.589	macromolecule modification
GO:0036211	0.584	protein modification process
GO:0010942	0.560	positive regulation of cell death
GO:0032446	0.470	protein modification by small protein conjugation
GO:0043068	0.439	positive regulation of programmed cell death
GO:0016567	0.394	protein ubiquitination
GO:0000209	0.333	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.990	E2 ubiquitin-conjugating enzyme.

[back to server]