StarFunc result for job id Q9H845

User Input

>input (621 residues)
MSGCGLFLRTTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVS
QDELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGF
SNTMYSRLGEIISMDGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCL
TEPASGSDAASIRSRATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKD
KITAFIVERDFGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNIL
NSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMT
YLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR
ILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVD
LGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINL
YGMTAVLSRASRSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKK
VSQQILEKRAYICAHPLDRTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H845	1.000	1.000	9.625E-92	621	1.000	1.000	Q9H845.pdb.gz	ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
2	AFDB:Q8JZN5	0.976	0.969	8.291E-80	625	0.852	0.846	Q8JZN5.pdb.gz	ACAD9_MOUSE Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus OX=10090 GN=Acad9 PE=1 SV=2
3	AFDB:P50544	0.901	0.854	9.838E-53	656	0.465	0.441	P50544.pdb.gz	ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadvl PE=1 SV=3
4	AFDB:A9JT52	0.899	0.848	1.962E-52	659	0.454	0.428	A9JT52.pdb.gz
5	AFDB:P49748	0.892	0.847	1.556E-51	655	0.452	0.429	P49748.pdb.gz	ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1
6	PDB:7s7gA	0.860	0.934	1.282E-49	571	0.430	0.468	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
7	AFDB:P9WQF7	0.824	0.788	9.861E-37	650	0.304	0.291	P9WQF7.pdb.gz	Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE10 PE=1 SV=1
8	AFDB:Q5U117	0.871	0.848	2.900E-36	639	0.272	0.264	Q5U117.pdb.gz	Q5U117_DROME Enigma OS=Drosophila melanogaster OX=7227 GN=Egm PE=1 SV=1
9	AFDB:Q9I296	0.565	0.894	1.433E-27	387	0.232	0.372	Q9I296.pdb.gz	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
10	AFDB:Q9FS87	0.568	0.843	1.702E-27	412	0.237	0.357	Q9FS87.pdb.gz	IVD_SOLTU Isovaleryl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum OX=4113 GN=IVD PE=1 SV=2
11	AFDB:A0A0S2Z3P9	0.565	0.805	2.621E-27	432	0.237	0.340	A0A0S2Z3P9.pdb.gz	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
12	PDB:1ivhA	0.568	0.899	1.487E-26	387	0.216	0.346	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
13	PDB:1jqiA	0.571	0.911	2.158E-25	384	0.225	0.365	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
14	PDB:6fahC	0.568	0.916	3.948E-25	379	0.208	0.340	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
15	PDB:1rx0A	0.566	0.899	4.494E-25	384	0.196	0.318	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
16	PDB:2a1tC	0.574	0.906	7.422E-24	388	0.208	0.332	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
17	PDB:2ix6A	0.539	0.791	4.472E-22	416	0.179	0.267	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
18	PDB:2r0mA	0.561	0.880	6.048E-22	390	0.169	0.269	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
19	PDB:6af6A	0.554	0.884	2.472E-20	383	0.166	0.269	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
20	PDB:4y9jB	0.612	0.638	5.764E-19	593	0.177	0.185	4y9jB.pdb.gz	Acyl-CoA Dehydrogenase Drives Heat Adaptation by Sequestering Fatty Acids

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45953	0.0	540	655	0.457	0.434	ACADV_RAT Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadvl PE=1 SV=1
2	P50544	0.0	544	656	0.462	0.438	ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadvl PE=1 SV=3
3	Q7T2C2	0.0	540	659	0.457	0.431	Q7T2C2_DANRE Acyl-Coenzyme A dehydrogenase, very long chain OS=Danio rerio OX=7955 GN=fb52d04 PE=1 SV=1
4	Q8JZN5	0.0	1085	625	0.860	0.854	ACAD9_MOUSE Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus OX=10090 GN=Acad9 PE=1 SV=2
5	Q9H845	0.0	1279	621	1.000	1.000	ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
6	Q9H9W4	0.0	1028	498	0.802	1.000	Q9H9W4_HUMAN Acyl-CoA dehydrogenase family member 9 OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
7	P49748	2.99e-175	514	655	0.441	0.418	ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1
8	D6RCD8	2.66e-106	320	173	0.259	0.931	D6RCD8_HUMAN Acyl-CoA dehydrogenase family member 9 (Fragment) OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
9	P9WQF7	1.82e-80	268	650	0.253	0.242	Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE10 PE=1 SV=1
10	P9WQG1	8.93e-76	248	389	0.237	0.378	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
11	Q9I296	1.55e-74	245	387	0.232	0.372	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
12	H2KZG6	2.72e-72	241	427	0.230	0.335	H2KZG6_CAEEL Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-1 PE=1 SV=1
13	Q95U46	1.16e-68	231	414	0.222	0.333	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
14	A0A0S2Z3P9	1.82e-68	231	432	0.225	0.324	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
15	P45954	1.82e-68	231	432	0.225	0.324	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1
16	Q9VVU1	3.63e-68	229	414	0.221	0.331	Q9VVU1_DROME FI09602p OS=Drosophila melanogaster OX=7227 GN=GH07925p PE=1 SV=1
17	E5KSD5	5.29e-68	229	412	0.242	0.364	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
18	P16219	5.29e-68	229	412	0.242	0.364	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
19	P12007	7.77e-68	229	424	0.225	0.330	IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ivd PE=1 SV=2
20	Q9FS88	8.04e-68	228	412	0.230	0.347	MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum OX=4113 GN=2MBCD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	5.9e-39	145.1	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	5.7e-07	41.3	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	4.4e-22	89.4	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	9.1e-21	86.0	Acyl-CoA dehydrogenase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260361	0.999	Complex I intermediate-associated protein 30, mitochondrial
2	9606.ENSP00000270517	0.999	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
3	9606.ENSP00000233627	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000263774	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
5	9606.ENSP00000323076	0.998	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
6	9606.ENSP00000356972	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
7	9606.ENSP00000418803	0.998	Complex I assembly factor TIMMDC1, mitochondrial
8	9606.ENSP00000423673	0.997	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
9	9606.ENSP00000351737	0.996	Complex I assembly factor TMEM126B, mitochondrial
10	9606.ENSP00000354665	0.974	NADH-ubiquinone oxidoreductase chain 6
11	9606.ENSP00000370023	0.954	Trifunctional enzyme subunit alpha, mitochondrial
12	9606.ENSP00000367346	0.942	Arginine-hydroxylase NDUFAF5, mitochondrial
13	9606.ENSP00000362060	0.940	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
14	9606.ENSP00000365388	0.904	Decaprenyl-diphosphate synthase subunit 1
15	9606.ENSP00000417142	0.902	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
16	9606.ENSP00000325136	0.870	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
17	9606.ENSP00000379430	0.869	NADH dehydrogenase (ubiquinone) complex I, assembly factor 6
18	9606.ENSP00000359151	0.863	Dihydrolipoamide branched chain transacylase E2
19	9606.ENSP00000252102	0.859	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
20	9606.ENSP00000358272	0.850	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003995	0.999	acyl-CoA dehydrogenase activity
GO:0097159	0.942	organic cyclic compound binding
GO:0043168	0.931	anion binding
GO:0036094	0.920	small molecule binding
GO:1901363	0.913	heterocyclic compound binding
GO:0000166	0.888	nucleotide binding
GO:0050660	0.638	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0006631	0.935	fatty acid metabolic process
GO:0071840	0.583	cellular component organization or biogenesis
GO:0010257	0.559	NADH dehydrogenase complex assembly
GO:0033108	0.558	mitochondrial respiratory chain complex assembly
GO:0032981	0.540	mitochondrial respiratory chain complex I assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.979	membrane
GO:0070013	0.930	intracellular organelle lumen
GO:0031090	0.899	organelle membrane
GO:0031966	0.789	mitochondrial membrane
GO:0005743	0.729	mitochondrial inner membrane
GO:0032991	0.430	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.

[back to server]