StarFunc result for job id Q9H875

User Input

>input (184 residues)
MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPP
PEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAA
EEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSF
TMGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CWV6	0.843	0.834	8.067E-22	186	0.924	0.914	Q9CWV6.pdb.gz	PKRI1_MOUSE PRKR-interacting protein 1 OS=Mus musculus OX=10090 GN=Prkrip1 PE=1 SV=2
2	PDB:7w5a2	0.637	0.939	3.614E-15	123	0.663	0.992	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
3	AFDB:D3ZWL1	0.200	0.077	1.043	677	0.190	0.052	D3ZWL1.pdb.gz	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
4	AFDB:Q6DRK9	0.144	0.074	1.043	362	0.196	0.099	Q6DRK9.pdb.gz	Q6DRK9_DANRE Kynurenine aminotransferase 1 OS=Danio rerio OX=7955 GN=surf6 PE=1 SV=1
5	AFDB:P08082	0.203	0.185	1.119	229	0.125	0.100	P08082.pdb.gz	CLCB_RAT Clathrin light chain B OS=Rattus norvegicus OX=10116 GN=Cltb PE=1 SV=1
6	AFDB:G5ECG0	0.300	0.221	1.202	260	0.125	0.088	G5ECG0.pdb.gz	TACC1_CAEEL Transforming acid coiled-coil-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=tac-1 PE=1 SV=1
7	AFDB:P70194	0.245	0.105	1.202	548	0.130	0.044	P70194.pdb.gz	CLC4F_MOUSE C-type lectin domain family 4 member F OS=Mus musculus OX=10090 GN=Clec4f PE=1 SV=1
8	AFDB:P40094	0.263	0.080	1.385	801	0.098	0.022	P40094.pdb.gz	COG3_YEAST Conserved oligomeric Golgi complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COG3 PE=1 SV=1
9	AFDB:Q9N658	0.236	0.097	1.487	541	0.190	0.065	Q9N658.pdb.gz	GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster OX=7227 GN=sens PE=1 SV=1
10	AFDB:Q5B4G8	0.300	0.192	1.596	317	0.168	0.098	Q5B4G8.pdb.gz	Q5B4G8_EMENI BZIP transcription factor (Fcr3), putative (AFU_orthologue AFUA_2G02540) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04562 PE=4 SV=1
11	AFDB:Q38FM0	0.311	0.166	1.713	376	0.152	0.074	Q38FM0.pdb.gz	Q38FM0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1710 PE=4 SV=1
12	PDB:7dvqR	0.161	0.123	3.202	241	0.114	0.087	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:7d63RJ	0.228	0.068	5.263	796	0.136	0.031	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
14	PDB:7d5sRN	0.313	0.109	7.504	607	0.130	0.040	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:7w59R	0.281	0.189	8.056	280	0.114	0.075	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:5ganG	0.128	0.077	8.649	318	0.076	0.044	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
17	PDB:2kogA	0.093	0.131	9.285	116	0.082	0.129	2kogA.pdb.gz
18	PDB:5gm6P	0.172	0.130	9.285	246	0.141	0.106	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6yxyBJ	0.124	0.083	9.285	293	0.114	0.072	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H875	9.36e-131	365	184	1.000	1.000	PKRI1_HUMAN PRKR-interacting protein 1 OS=Homo sapiens OX=9606 GN=PRKRIP1 PE=1 SV=1
2	Q9CWV6	2.24e-87	256	186	0.832	0.823	PKRI1_MOUSE PRKR-interacting protein 1 OS=Mus musculus OX=10090 GN=Prkrip1 PE=1 SV=2
3	Q8IDX6	0.42	33.5	3130	0.125	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
4	Q9Y1L3	0.42	33.5	2151	0.125	0.011	Q9Y1L3_DROME Kismet OS=Drosophila melanogaster OX=7227 GN=kis PE=2 SV=1
5	M9NCY5	0.43	33.5	5343	0.125	0.004	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
6	Q9VPL9	0.43	33.5	5322	0.125	0.004	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3
7	B7Z002	0.45	33.5	5517	0.125	0.004	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
8	Q9VPL6	0.45	33.5	2151	0.125	0.011	Q9VPL6_DROME Kismet, isoform B OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
9	M9NEL3	0.47	33.5	5191	0.125	0.004	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
10	M9NDB7	0.48	33.5	5252	0.125	0.004	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
11	E2RQ08	0.52	33.1	607	0.092	0.028	RPN1_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Canis lupus familiaris OX=9615 GN=RPN1 PE=1 SV=1
12	Q8I4Z1	0.52	33.1	1846	0.141	0.014	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
13	P04843	0.56	33.1	607	0.092	0.028	RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1
14	Q9USP9	0.60	33.1	589	0.114	0.036	YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC902.04 PE=1 SV=1
15	Q8II80	0.93	32.3	1570	0.158	0.018	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
16	B7Z4L4	1.1	32.0	435	0.092	0.039	B7Z4L4_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1
17	Q91YQ5	1.6	31.6	608	0.092	0.028	RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus OX=10090 GN=Rpn1 PE=1 SV=1
18	C0H5F4	2.8	31.2	3254	0.109	0.006	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
19	P07153	3.3	30.8	605	0.087	0.026	RPN1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Rattus norvegicus OX=10116 GN=Rpn1 PE=2 SV=1
20	Q8I4N4	3.4	30.8	1077	0.185	0.032	DAF11_CAEEL Receptor-type guanylate cyclase daf-11 OS=Caenorhabditis elegans OX=6239 GN=daf-11 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06658 DUF1168	3.1e-42	155.0	Protein of unknown function (DUF1168)
2	PF03543 Peptidase_C58	5.2e+02	11.7	Yersinia/Haemophilus virulence surface antigen

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263384	0.958	Protein FAM32A
2	9606.ENSP00000272091	0.954	Replication stress response regulator SDE2
3	9606.ENSP00000297151	0.944	Pre-mRNA-splicing factor SLU7
4	9606.ENSP00000366557	0.939	Crooked neck-like protein 1
5	9606.ENSP00000415078	0.936	Cactin
6	9606.ENSP00000254193	0.935	U2 small nuclear ribonucleoprotein A
7	9606.ENSP00000400591	0.906	Small nuclear ribonucleoprotein E
8	9606.ENSP00000360532	0.895	Cell division cycle 5-like protein
9	9606.ENSP00000199814	0.890	Pre-mRNA-splicing factor RBM22
10	9606.ENSP00000387006	0.889	Pre-mRNA-splicing factor CWC22 homolog
11	9606.ENSP00000357928	0.886	Pre-mRNA-processing factor 17
12	9606.ENSP00000272348	0.885	Small nuclear ribonucleoprotein G
13	9606.ENSP00000300413	0.878	Small nuclear ribonucleoprotein Sm D1
14	9606.ENSP00000262415	0.875	ATP-dependent RNA helicase DHX8
15	9606.ENSP00000342374	0.855	Small nuclear ribonucleoprotein Sm D2
16	9606.ENSP00000301740	0.847	Serine/arginine repetitive matrix protein 2
17	9606.ENSP00000317123	0.845	U5 small nuclear ribonucleoprotein 200 kDa helicase
18	9606.ENSP00000360464	0.841	NF-kappa-B-activating protein
19	9606.ENSP00000264645	0.835	Protein CASC3
20	9606.ENSP00000392094	0.833	116 kDa U5 small nuclear ribonucleoprotein component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.983	RNA binding
GO:0004860	0.683	protein kinase inhibitor activity
GO:0003725	0.650	double-stranded RNA binding
GO:0019900	0.637	kinase binding
GO:0019901	0.619	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.843	regulation of biological process
GO:0050794	0.834	regulation of cellular process
GO:0019222	0.777	regulation of metabolic process
GO:0048519	0.744	negative regulation of biological process
GO:0031323	0.709	regulation of cellular metabolic process
GO:0032501	0.634	multicellular organismal process
GO:0080090	0.534	regulation of primary metabolic process
GO:0003014	0.519	renal system process
GO:0051171	0.497	regulation of nitrogen compound metabolic process
GO:0060255	0.492	regulation of macromolecule metabolic process
GO:0009987	0.413	cellular process
GO:0051174	0.412	regulation of phosphorus metabolic process
GO:0008152	0.392	metabolic process
GO:0048523	0.342	negative regulation of cellular process
GO:0071704	0.328	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.959	nucleoplasm
GO:0043232	0.827	intracellular non-membrane-bounded organelle
GO:0005576	0.756	extracellular region
GO:0005737	0.692	cytoplasm
GO:0031982	0.635	vesicle
GO:0043230	0.545	extracellular organelle
GO:0005730	0.534	nucleolus
GO:0005615	0.527	extracellular space
GO:1903561	0.512	extracellular vesicle
GO:0070062	0.497	extracellular exosome
GO:0032991	0.417	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]