StarFunc result for job id Q9H8G2

User Input

>input (361 residues)
MTGKKSSREKRRKRSSQEAAAALAAPDIVPALASGSSGSTSGCGSAGGCGSVSCCGNANF
SGSVTGGGSGGSCWGGSSVERSERRKRRSTDSSSVSGSLQQETKYILPTLEKELFLAEHS
DLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSIEEIKKLCQ
EQLELLSEKKILKILEGDNGMDSDMEEEADDGSKMGSDLVSQQDICIDSASSVRENKQPE
GLELKQGKGEDSDVLSINADAYDSDIEGPCNEEAAAPEAPENTVQSEAGQIDDLEKDIEK
SVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKALMKAGDIKKP
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8G2	1.000	1.000	2.447E-49	361	1.000	1.000	Q9H8G2.pdb.gz	CAAP1_HUMAN Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2
2	AFDB:Q9VE87	0.104	0.079	4.919E-3	604	0.155	0.093	Q9VE87.pdb.gz	HMW_DROME Protein hemingway OS=Drosophila melanogaster OX=7227 GN=hmw PE=2 SV=2
3	AFDB:Q9NQS1	0.094	0.094	5.041E-2	362	0.158	0.157	Q9NQS1.pdb.gz	AVEN_HUMAN Cell death regulator Aven OS=Homo sapiens OX=9606 GN=AVEN PE=1 SV=1
4	AFDB:Q9VRY7	0.076	0.045	9.887E-2	659	0.177	0.097	Q9VRY7.pdb.gz	Q9VRY7_DROME GH13213p OS=Drosophila melanogaster OX=7227 GN=Rsph3 PE=1 SV=1
5	AFDB:Q9VUD1	0.104	0.093	9.887E-2	388	0.144	0.134	Q9VUD1.pdb.gz	Q9VUD1_DROME IP01552p OS=Drosophila melanogaster OX=7227 GN=Sox21a PE=2 SV=1
6	AFDB:P78413	0.106	0.084	1.343E-1	519	0.169	0.118	P78413.pdb.gz	IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens OX=9606 GN=IRX4 PE=1 SV=2
7	AFDB:Q659C4	0.094	0.045	1.343E-1	914	0.144	0.057	Q659C4.pdb.gz	LAR1B_HUMAN La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B PE=1 SV=2
8	AFDB:Q24340	0.065	0.054	1.428E-1	604	0.155	0.093	Q24340.pdb.gz	Q24340_DROME Small forked protein OS=Drosophila melanogaster OX=7227 GN=f PE=2 SV=1
9	AFDB:Q8GXA4	0.100	0.079	1.716E-1	489	0.175	0.129	Q8GXA4.pdb.gz	WIP1_ARATH WPP domain-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=WIP1 PE=1 SV=1
10	AFDB:A0A0B4KEE7	0.106	0.034	2.192E-1	1486	0.125	0.030	A0A0B4KEE7.pdb.gz	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
11	PDB:1xwrA	0.103	0.331	3.490	79	0.017	0.076	1xwrA.pdb.gz
12	PDB:4i43A	0.077	0.081	6.056	334	0.053	0.057	4i43A.pdb.gz
13	PDB:5ganG	0.059	0.066	7.277	318	0.083	0.094	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
14	PDB:2kogA	0.059	0.143	8.225	116	0.050	0.155	2kogA.pdb.gz
15	PDB:2aczC	0.054	0.118	8.744	129	0.030	0.085	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
16	PDB:6v6bB	0.074	0.051	8.744	572	0.025	0.016	6v6bB.pdb.gz
17	PDB:6h62A	0.044	0.043	9.296	370	0.014	0.014	6h62A.pdb.gz	Structural and Biochemical Investigation of the Heterodimeric Murine tRNA-Guanine Transglycosylase.
18	PDB:6hivCv	0.075	0.032	9.296	1059	0.047	0.016	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:7b93V	0.097	0.209	9.296	115	0.042	0.130	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:6qw64A	0.071	0.099	9.883	239	0.042	0.063	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H8G2	0.0	717	361	1.000	1.000	CAAP1_HUMAN Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2
2	Q7M732	5.7	31.6	1744	0.083	0.017	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
3	H0Y6E5	6.3	30.8	218	0.069	0.115	H0Y6E5_HUMAN Serine/threonine-protein phosphatase 2A activator (Fragment) OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=1
4	O14841	6.7	31.6	1288	0.050	0.014	OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens OX=9606 GN=OPLAH PE=1 SV=3
5	P50446	7.8	31.2	553	0.053	0.034	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
6	Q9Z331	8.4	30.8	562	0.053	0.034	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	G5EBH0	9.9	30.8	1431	0.050	0.013	PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15335 CAAP1	1.4e-24	97.7	Caspase activity and apoptosis inhibitor 1
2	PF01783 Ribosomal_L32p	1.3e+02	14.2	Ribosomal L32p protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355929	0.647	Angel homolog 2
2	9606.ENSP00000431391	0.629	Apoptosis inhibitor 5
3	9606.ENSP00000324827	0.605	A-kinase anchor protein 17A
4	9606.ENSP00000261658	0.600	Bifunctional apoptosis regulator
5	9606.ENSP00000479258	0.556	Proapoptotic nucleolar protein 1
6	9606.ENSP00000357125	0.501	Transmembrane protein 244

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.988	heterocyclic compound binding
GO:0097159	0.988	organic cyclic compound binding
GO:0003676	0.952	nucleic acid binding
GO:0003824	0.649	catalytic activity
GO:0003723	0.427	RNA binding
GO:0016787	0.360	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0042981	0.978	regulation of apoptotic process
GO:0009966	0.951	regulation of signal transduction
GO:0080090	0.935	regulation of primary metabolic process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0048523	0.933	negative regulation of cellular process
GO:0043066	0.921	negative regulation of apoptotic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0009968	0.852	negative regulation of signal transduction
GO:0050790	0.847	regulation of catalytic activity
GO:0051172	0.836	negative regulation of nitrogen compound metabolic process
GO:0010605	0.832	negative regulation of macromolecule metabolic process
GO:0045861	0.755	negative regulation of proteolysis
GO:0051346	0.740	negative regulation of hydrolase activity
GO:2000116	0.727	regulation of cysteine-type endopeptidase activity
GO:2001233	0.713	regulation of apoptotic signaling pathway
GO:0010951	0.684	negative regulation of endopeptidase activity
GO:2001234	0.682	negative regulation of apoptotic signaling pathway
GO:0043281	0.638	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2000117	0.580	negative regulation of cysteine-type endopeptidase activity
GO:0043154	0.565	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009987	0.560	cellular process
GO:0031323	0.348	regulation of cellular metabolic process
GO:0071704	0.325	organic substance metabolic process
GO:0044238	0.304	primary metabolic process
GO:0006807	0.304	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0016604	0.955	nuclear body
GO:0032991	0.373	protein-containing complex
GO:0005829	0.321	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.360	Hydrolases.

[back to server]