StarFunc result for job id Q9H8L6

User Input

>input (949 residues)
MILSLLFSLGGPLGWGLLGAWAQASSTSLSDLQSSRTPGVWKAEAEDTGKDPVGRNWCPY
PMSKLVTLLALCKTEKFLIHSQQPCPQGAPDCQKVKVMYRMAHKPVYQVKQKVLTSLAWR
CCPGYTGPNCEHHDSMAIPEPADPGDSHQEPQDGPVSFKPGHLAAVINEVEVQQEQQEHL
LGDLQNDVHRVADSLPGLWKALPGNLTAAVMEANQTGHEFPDRSLEQVLLPHVDTFLQVH
FSPIWRSFNQSLHSLTQAIRNLSLDVEANRQAISRVQDSAVARADFQELGAKFEAKVQEN
TQRVGQLRQDVEDRLHAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTNGSLVLATPGA
GARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESD
ETFDQISKVERQVEELQVNHTALRELRVILMEKSLIMEENKEEVERQLLELNLTLQHLQG
GHADLIKYVKDCNCQKLYLDLDVIREGQRDATRALEETQVSLDERRQLDGSSLQALQNAV
DAVSLAVDAHKAEGERARAATSRLRSQVQALDDEVGALKAAAAEARHEVRQLHSAFAALL
EDALRHEAVLAALFGEEVLEEMSEQTPGPLPLSYEQIRVALQDAASGLQEQALGWDELAA
RVTALEQASEPPRPAEHLEPSHDAGREEAATTALAGLARELQSLSNDVKNVGRCCEAEAG
AGAASLNASLHGLHNALFATQRSLEQHQRLFHSLFGNFQGLMEANVSLDLGKLQTMLSRK
GKKQQKDLEAPRKRDKKEAEPLVDIRVTGPVPGALGAALWEAGSPVAFYASFSEGTAALQ
TVKFNTTYINIGSSYFPEHGYFRAPERGVYLFAVSVEFGPGPGTGQLVFGGHHRTPVCTT
GQGSGSTATVFAMAELQKGERVWFELTQGSITKRSLSGTAFGGFLMFKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8L6	1.000	1.000	0.000	949	1.000	1.000	Q9H8L6.pdb.gz	MMRN2_HUMAN Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2
2	AFDB:A6H6E2	0.301	0.302	2.367E-92	943	0.662	0.666	A6H6E2.pdb.gz	MMRN2_MOUSE Multimerin-2 OS=Mus musculus OX=10090 GN=Mmrn2 PE=1 SV=1
3	AFDB:F1QC17	0.137	0.129	1.049E-28	1014	0.188	0.176	F1QC17.pdb.gz	EMI1A_DANRE EMILIN-1-A OS=Danio rerio OX=7955 GN=emilin1a PE=3 SV=1
4	AFDB:Q99K41	0.134	0.126	2.310E-26	1017	0.195	0.182	Q99K41.pdb.gz	EMIL1_MOUSE EMILIN-1 OS=Mus musculus OX=10090 GN=Emilin1 PE=1 SV=1
5	AFDB:Q9Y6C2	0.129	0.121	6.629E-25	1016	0.217	0.203	Q9Y6C2.pdb.gz	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
6	AFDB:Q4ZJM9	0.134	0.514	4.868E-15	238	0.041	0.164	Q4ZJM9.pdb.gz	C1QL4_MOUSE Complement C1q-like protein 4 OS=Mus musculus OX=10090 GN=C1ql4 PE=1 SV=1
7	AFDB:O75973	0.134	0.473	2.939E-14	258	0.038	0.140	O75973.pdb.gz	C1QRF_HUMAN C1q-related factor OS=Homo sapiens OX=9606 GN=C1QL1 PE=1 SV=1
8	AFDB:Q9ESN4	0.135	0.479	1.574E-13	255	0.035	0.129	Q9ESN4.pdb.gz	C1QL3_MOUSE Complement C1q-like protein 3 OS=Mus musculus OX=10090 GN=C1ql3 PE=1 SV=1
9	AFDB:E1BSP0	0.133	0.491	7.046E-13	243	0.039	0.152	E1BSP0.pdb.gz
10	AFDB:P02745	0.131	0.485	8.434E-13	245	0.042	0.163	P02745.pdb.gz	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
11	PDB:5kc6B	0.126	0.760	9.811E-12	144	0.033	0.215	5kc6B.pdb.gz
12	PDB:5h4bA	0.125	0.803	6.291E-11	136	0.033	0.228	5h4bA.pdb.gz
13	PDB:7e57B	0.095	0.649	1.842E-5	123	0.021	0.163	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:2waaA	0.080	0.193	1.861E-3	335	0.020	0.057	2waaA.pdb.gz
15	PDB:4fixA	0.055	0.078	2.365E-3	629	0.021	0.032	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:6oj0A	0.084	0.317	4.307E-3	178	0.015	0.079	6oj0A.pdb.gz
17	PDB:5jovA	0.060	0.060	5.155E-3	949	0.017	0.017	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
18	PDB:2qnkA	0.054	0.148	1.193E-2	286	0.011	0.035	2qnkA.pdb.gz
19	PDB:1js9C	0.084	0.292	1.709E-2	189	0.018	0.090	1js9C.pdb.gz
20	PDB:5a3oA	0.078	0.459	1.709E-2	114	0.008	0.070	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H6E2	0.0	1243	943	0.668	0.672	MMRN2_MOUSE Multimerin-2 OS=Mus musculus OX=10090 GN=Mmrn2 PE=1 SV=1
2	Q9H8L6	0.0	1949	949	1.000	1.000	MMRN2_HUMAN Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2
3	B2RPV6	1.26e-13	77.8	1210	0.089	0.069	MMRN1_MOUSE Multimerin-1 OS=Mus musculus OX=10090 GN=Mmrn1 PE=1 SV=2
4	Q13201	5.44e-13	75.9	1228	0.089	0.068	MMRN1_HUMAN Multimerin-1 OS=Homo sapiens OX=9606 GN=MMRN1 PE=1 SV=3
5	Q9Y6C2	8.42e-13	75.1	1016	0.056	0.052	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
6	Q99K41	4.11e-12	72.8	1017	0.050	0.046	EMIL1_MOUSE EMILIN-1 OS=Mus musculus OX=10090 GN=Emilin1 PE=1 SV=1
7	F1QC17	4.95e-12	72.8	1014	0.102	0.096	EMI1A_DANRE EMILIN-1-A OS=Danio rerio OX=7955 GN=emilin1a PE=3 SV=1
8	Q5TZ63	6.05e-12	72.4	1008	0.102	0.096	Q5TZ63_DANRE EMILIN-1 precursor OS=Danio rerio OX=7955 GN=im:7159005 PE=1 SV=1
9	Q8K482	2.70e-11	70.1	1074	0.034	0.030	EMIL2_MOUSE EMILIN-2 OS=Mus musculus OX=10090 GN=Emilin2 PE=1 SV=1
10	Q9BXX0	5.50e-10	65.9	1053	0.036	0.032	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3
11	P59900	2.28e-09	63.9	758	0.037	0.046	EMIL3_MOUSE EMILIN-3 OS=Mus musculus OX=10090 GN=Emilin3 PE=2 SV=1
12	F1SDV5	5.81e-09	62.4	766	0.051	0.063	F1SDV5_PIG Elastin microfibril interfacer 3 OS=Sus scrofa OX=9823 GN=EMILIN3 PE=4 SV=2
13	Q9NT22	8.61e-09	62.0	766	0.053	0.065	EMIL3_HUMAN EMILIN-3 OS=Homo sapiens OX=9606 GN=EMILIN3 PE=1 SV=2
14	Q91VF6	4.87e-08	58.9	440	0.030	0.064	COQA1_MOUSE Collagen alpha-1(XXVI) chain OS=Mus musculus OX=10090 GN=Col26a1 PE=1 SV=1
15	Q96A83	1.37e-07	57.4	441	0.028	0.061	COQA1_HUMAN Collagen alpha-1(XXVI) chain OS=Homo sapiens OX=9606 GN=COL26A1 PE=1 SV=1
16	Q91VF5	3.38e-07	56.2	444	0.028	0.061	EMID1_MOUSE EMI domain-containing protein 1 OS=Mus musculus OX=10090 GN=Emid1 PE=2 SV=1
17	Q9R171	1.86e-04	45.8	193	0.050	0.244	CBLN1_MOUSE Cerebellin-1 OS=Mus musculus OX=10090 GN=Cbln1 PE=1 SV=1
18	P23435	1.91e-04	45.8	193	0.050	0.244	CBLN1_HUMAN Cerebellin-1 OS=Homo sapiens OX=9606 GN=CBLN1 PE=1 SV=1
19	Q5RJ80	5.94e-04	46.2	914	0.036	0.037	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
20	Q05A80	6.52e-04	46.2	1031	0.041	0.038	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	10	17.9	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF00386 C1q	1.1e-20	85.5	C1q domain
3	PF06631 DUF1154	2.7e+02	12.8	Protein of unknown function (DUF1154)
4	PF07889 DUF1664	0.075	24.5	Protein of unknown function (DUF1664)
5	PF07546 EMI	8.8e-14	63.3	EMI domain
6	PF13851 GAS	29	15.5	Growth-arrest specific micro-tubule binding
7	PF02403 Seryl_tRNA_N	34	16.1	Seryl-tRNA synthetase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353013	0.969	C-type lectin domain containing 14A
2	9606.ENSP00000273258	0.684	PRA1 family protein 3
3	9606.ENSP00000342790	0.658	Family with sequence similarity 25 member A
4	9606.ENSP00000246006	0.641	Complement component C1q receptor
5	9606.ENSP00000417185	0.619	Von Willebrand factor A domain-containing protein 1
6	9606.ENSP00000478570	0.610	Vascular endothelial growth factor A
7	9606.ENSP00000485370	0.604	Protein FAM25A
8	9606.ENSP00000308057	0.598	Beta-synuclein
9	9606.ENSP00000357131	0.560	Rho GTPase-activating protein 18
10	9606.ENSP00000262487	0.544	Isthmin-1
11	9606.ENSP00000236040	0.526	Prolyl 3-hydroxylase 1
12	9606.ENSP00000363207	0.518	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5
13	9606.ENSP00000282397	0.515	Vascular endothelial growth factor receptor 1
14	9606.ENSP00000364298	0.504	FK506-binding protein-like
15	9606.ENSP00000455215	0.501	Adhesion G-protein coupled receptor G1
16	9606.ENSP00000262659	0.500	Cerebral cavernous malformations 2 protein-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0048518	0.968	positive regulation of biological process
GO:2000145	0.962	regulation of cell motility
GO:0009987	0.960	cellular process
GO:0001936	0.957	regulation of endothelial cell proliferation
GO:0010632	0.949	regulation of epithelial cell migration
GO:0050680	0.935	negative regulation of epithelial cell proliferation
GO:0050793	0.897	regulation of developmental process
GO:0009966	0.895	regulation of signal transduction
GO:0030336	0.893	negative regulation of cell migration
GO:0032101	0.886	regulation of response to external stimulus
GO:0001937	0.880	negative regulation of endothelial cell proliferation
GO:0010594	0.852	regulation of endothelial cell migration
GO:0022603	0.840	regulation of anatomical structure morphogenesis
GO:0048585	0.827	negative regulation of response to stimulus
GO:0032501	0.795	multicellular organismal process
GO:0090287	0.783	regulation of cellular response to growth factor stimulus
GO:0048856	0.765	anatomical structure development
GO:1905330	0.738	regulation of morphogenesis of an epithelium
GO:0051241	0.712	negative regulation of multicellular organismal process
GO:0010633	0.674	negative regulation of epithelial cell migration
GO:0030947	0.666	regulation of vascular endothelial growth factor receptor signaling pathway
GO:0007275	0.615	multicellular organism development
GO:0043535	0.561	regulation of blood vessel endothelial cell migration
GO:0090288	0.539	negative regulation of cellular response to growth factor stimulus
GO:0048522	0.532	positive regulation of cellular process
GO:0051094	0.522	positive regulation of developmental process
GO:2000026	0.511	regulation of multicellular organismal development
GO:0048731	0.499	system development
GO:0090049	0.413	regulation of cell migration involved in sprouting angiogenesis
GO:0051240	0.401	positive regulation of multicellular organismal process
GO:0048870	0.336	cell motility
GO:0010596	0.327	negative regulation of endothelial cell migration
GO:0050896	0.319	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.994	extracellular region
GO:0031982	0.989	vesicle
GO:0070062	0.972	extracellular exosome
GO:0016020	0.824	membrane
GO:0005622	0.746	intracellular anatomical structure
GO:0043231	0.720	intracellular membrane-bounded organelle
GO:0005737	0.632	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]