StarFunc result for job id Q9H8M2

User Input

>input (597 residues)
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8M2	1.000	1.000	7.162E-88	597	1.000	1.000	Q9H8M2.pdb.gz	BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2
2	AFDB:Q9NPI1	0.178	0.164	4.397E-24	651	0.330	0.303	Q9NPI1.pdb.gz	BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1
3	AFDB:O88665	0.178	0.165	3.796E-23	651	0.325	0.298	O88665.pdb.gz	BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus OX=10090 GN=Brd7 PE=1 SV=1
4	AFDB:Q9VLX2	0.178	0.128	5.840E-18	861	0.219	0.152	Q9VLX2.pdb.gz	Q9VLX2_DROME Bromodomain containing 7/9 OS=Drosophila melanogaster OX=7227 GN=Brd7-9 PE=1 SV=1
5	AFDB:Q8VY17	0.167	0.111	2.352E-13	916	0.203	0.132	Q8VY17.pdb.gz	Q8VY17_ARATH DNA-binding bromodomain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g55040 PE=1 SV=1
6	AFDB:A4FVS4	0.185	0.190	5.004E-11	580	0.168	0.172	A4FVS4.pdb.gz	A4FVS4_ARATH At1g76380 OS=Arabidopsis thaliana OX=3702 GN=At1g76380 PE=1 SV=1
7	AFDB:Q9LM88	0.171	0.157	7.975E-11	652	0.173	0.158	Q9LM88.pdb.gz	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
8	AFDB:Q7Y214	0.169	0.170	3.229E-10	590	0.179	0.181	Q7Y214.pdb.gz	GTE7_ARATH Transcription factor GTE7 OS=Arabidopsis thaliana OX=3702 GN=GTE7 PE=2 SV=1
9	AFDB:Q8H1D7	0.174	0.210	4.320E-10	487	0.154	0.189	Q8H1D7.pdb.gz	GTE5_ARATH Transcription factor GTE5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GTE5 PE=1 SV=1
10	AFDB:Q95Y80	0.177	0.130	7.299E-10	853	0.154	0.108	Q95Y80.pdb.gz	BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans OX=6239 GN=bet-1 PE=1 SV=3
11	PDB:6v8oO	0.138	0.207	5.762E-3	384	0.085	0.133	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
12	PDB:3javA	0.079	0.035	1.264E-1	2327	0.116	0.030	3javA.pdb.gz
13	PDB:5xjt2	0.077	0.158	9.160E-1	217	0.032	0.088	5xjt2.pdb.gz	Structures of 7S mutant complexes
14	PDB:7v2wJ	0.055	0.107	1.156	236	0.062	0.157	7v2wJ.pdb.gz
15	PDB:4wsnF	0.049	0.084	1.226	288	0.032	0.066	4wsnF.pdb.gz	Cullin-RING ubiquitin E3 ligase regulation by the COP9 signalosome.
16	PDB:7myjC	0.070	0.077	1.226	465	0.042	0.054	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:5j0nF	0.062	0.088	1.299	356	0.028	0.048	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
18	PDB:5svag	0.054	0.158	1.377	172	0.034	0.116	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
19	PDB:6tljS	0.089	0.155	1.377	293	0.047	0.096	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
20	PDB:7m2wF	0.049	0.044	1.377	674	0.052	0.046	7m2wF.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UQU0	0.0	988	596	0.920	0.921	BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus OX=10090 GN=Brd9 PE=1 SV=1
2	Q9H8M2	0.0	1226	597	1.000	1.000	BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2
3	O88665	1.91e-96	310	651	0.362	0.332	BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus OX=10090 GN=Brd7 PE=1 SV=1
4	Q9NPI1	4.72e-63	221	651	0.201	0.184	BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1
5	Q9VLX2	6.95e-46	176	861	0.240	0.166	Q9VLX2_DROME Bromodomain containing 7/9 OS=Drosophila melanogaster OX=7227 GN=Brd7-9 PE=1 SV=1
6	D3ZUW8	7.36e-19	93.6	1189	0.109	0.055	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
7	G5E8P1	9.04e-19	93.2	1058	0.109	0.061	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
8	O95696	8.16e-18	90.1	1058	0.075	0.043	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
9	Q8VY17	2.20e-17	88.6	916	0.075	0.049	Q8VY17_ARATH DNA-binding bromodomain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g55040 PE=1 SV=1
10	Q9LM88	1.16e-16	85.9	652	0.072	0.066	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
11	A4FVS4	3.97e-16	84.0	580	0.067	0.069	A4FVS4_ARATH At1g76380 OS=Arabidopsis thaliana OX=3702 GN=At1g76380 PE=1 SV=1
12	Q93ZB7	8.22e-15	80.1	620	0.089	0.085	GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana OX=3702 GN=GTE11 PE=1 SV=1
13	Q9ULD4	5.49e-14	77.8	1205	0.070	0.035	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
14	Q7JVP4	9.78e-14	77.0	1430	0.064	0.027	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
15	P55201	3.82e-13	75.1	1214	0.070	0.035	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
16	B2RRD7	4.17e-13	75.1	1212	0.070	0.035	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
17	Q803M2	8.33e-13	73.9	899	0.075	0.050	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
18	A0A5F9ZH11	3.08e-11	68.9	1253	0.072	0.034	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
19	Q9UUK2	4.86e-10	64.3	454	0.055	0.073	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
20	Q9H0E9	1.30e-09	63.9	1235	0.050	0.024	BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	3.1e-21	86.6	Bromodomain
2	PF12024 DUF3512	5.7e-52	187.7	Domain of unknown function (DUF3512)
3	PF03666 NPR3	2.7e+02	11.8	Nitrogen Permease regulator of amino acid transport activity 3
4	PF05793 TFIIF_alpha	54	13.9	Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419765

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414516	0.995	Protein SSXT
2	9606.ENSP00000395654	0.994	Transcription activator BRG1
3	9606.ENSP00000313933	0.992	BRD4-interacting chromatin-remodeling complex-associated protein-like
4	9606.ENSP00000378414	0.992	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
5	9606.ENSP00000267064	0.990	SWI/SNF complex subunit SMARCC2
6	9606.ENSP00000265773	0.987	Probable global transcription activator SNF2L2
7	9606.ENSP00000379946	0.981	BRD4-interacting chromatin-remodeling complex-associated protein
8	9606.ENSP00000397552	0.975	Actin-like protein 6A
9	9606.ENSP00000323967	0.974	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
10	9606.ENSP00000254480	0.971	SWI/SNF complex subunit SMARCC1
11	9606.ENSP00000263121	0.970	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
12	9606.ENSP00000392617	0.962	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
13	9606.ENSP00000262188	0.957	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
14	9606.ENSP00000344546	0.957	AT-rich interactive domain-containing protein 1B
15	9606.ENSP00000320485	0.954	AT-rich interactive domain-containing protein 1A
16	9606.ENSP00000310275	0.893	Barrier-to-autointegration factor
17	9606.ENSP00000160382	0.879	Actin-like protein 6B
18	9606.ENSP00000369674	0.866	B-cell CLL/lymphoma 7 protein family member C
19	9606.ENSP00000445868	0.856	B-cell CLL/lymphoma 7 protein family member A
20	9606.ENSP00000263377	0.809	Bromodomain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070577	0.999	lysine-acetylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0009987	0.989	cellular process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0048518	0.976	positive regulation of biological process
GO:0009893	0.963	positive regulation of metabolic process
GO:0048522	0.956	positive regulation of cellular process
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0071840	0.899	cellular component organization or biogenesis
GO:0016043	0.878	cellular component organization
GO:0051173	0.785	positive regulation of nitrogen compound metabolic process
GO:0045893	0.765	positive regulation of DNA-templated transcription
GO:0006325	0.728	chromatin organization
GO:0006357	0.658	regulation of transcription by RNA polymerase II
GO:0006338	0.633	chromatin remodeling
GO:0008152	0.584	metabolic process
GO:0071704	0.566	organic substance metabolic process
GO:0044238	0.554	primary metabolic process
GO:0006807	0.535	nitrogen compound metabolic process
GO:0043170	0.471	macromolecule metabolic process
GO:0048523	0.466	negative regulation of cellular process
GO:0010605	0.320	negative regulation of macromolecule metabolic process
GO:0050896	0.315	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016514	1.000	SWI/SNF complex
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]