StarFunc result for job id Q9H8N7

User Input

>input (513 residues)
MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKE
VLKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVE
EVWLAELQGPCPQAPPLEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCS
PVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPK
YLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRH
VKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMT
GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPV
SPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKAR
GEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8N7	1.000	1.000	5.273E-79	513	1.000	1.000	Q9H8N7.pdb.gz	ZN395_HUMAN Zinc finger protein 395 OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=2
2	AFDB:E9Q5N9	0.193	0.194	1.348E-60	508	0.821	0.829	E9Q5N9.pdb.gz	E9Q5N9_MOUSE Zinc finger protein 395 OS=Mus musculus OX=10090 GN=Zfp395 PE=1 SV=1
3	AFDB:Q21338	0.100	0.045	1.805E-4	1208	0.150	0.064	Q21338.pdb.gz	SPT5H_CAEEL Transcription elongation factor SPT5 OS=Caenorhabditis elegans OX=6239 GN=spt-5 PE=3 SV=3
4	AFDB:Q9NP73	0.104	0.051	3.683E-4	1137	0.146	0.066	Q9NP73.pdb.gz	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
5	AFDB:F1R237	0.108	0.031	1.654E-2	2117	0.117	0.028	F1R237.pdb.gz	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
6	AFDB:Q9D8C3	0.108	0.050	1.654E-2	1166	0.158	0.069	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
7	AFDB:F4JW79	0.095	0.041	4.821E-2	1493	0.127	0.044	F4JW79.pdb.gz	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
8	PDB:4v6iBU	0.083	0.243	5.068E-2	160	0.025	0.081	4v6iBU.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
9	PDB:4pa0B	0.085	0.048	6.057E-2	920	0.023	0.013	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
10	PDB:3p8bB	0.099	0.331	6.429E-2	147	0.019	0.068	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
11	PDB:3mp8A	0.096	0.096	6.822E-2	513	0.016	0.016	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
12	PDB:2lqnA	0.090	0.140	1.034E-1	303	0.029	0.050	2lqnA.pdb.gz
13	AFDB:Q5TCZ1	0.096	0.045	1.406E-1	1133	0.140	0.064	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
14	PDB:7zq6u	0.082	0.408	1.478E-1	91	0.021	0.121	7zq6u.pdb.gz	Modulating co-translational protein folding by rational design and ribosome engineering.
15	PDB:8dmbP	0.096	0.146	1.478E-1	328	0.019	0.030	8dmbP.pdb.gz	Structure of the OMEGA nickase IsrB in complex with omega RNA and target DNA.
16	PDB:1k9aB	0.101	0.116	1.664E-1	441	0.010	0.011	1k9aB.pdb.gz
17	PDB:4v6wCY	0.083	0.284	1.766E-1	131	0.021	0.084	4v6wCY.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:6hiwDB	0.089	0.042	1.766E-1	1111	0.016	0.007	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	AFDB:A2CG63	0.101	0.042	6.594E-1	1314	0.138	0.054	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
20	AFDB:Q9W3Q5	0.052	0.025	8.364E-1	1268	0.135	0.054	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q5N9	0.0	742	508	0.813	0.821	E9Q5N9_MOUSE Zinc finger protein 395 OS=Mus musculus OX=10090 GN=Zfp395 PE=1 SV=1
2	Q3U227	0.0	745	508	0.815	0.823	Q3U227_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp395 PE=2 SV=1
3	Q9H8N7	0.0	1040	513	1.000	1.000	ZN395_HUMAN Zinc finger protein 395 OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=2
4	E5RFV4	7.44e-130	377	187	0.365	1.000	E5RFV4_HUMAN Zinc finger protein 395 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=8
5	E5RGF1	2.66e-106	315	156	0.304	1.000	E5RGF1_HUMAN Zinc finger protein 395 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=1
6	E5RG59	3.30e-82	253	124	0.242	1.000	E5RG59_HUMAN Zinc finger protein 395 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=1
7	Q6ZNC4	7.35e-76	246	412	0.331	0.413	ZN704_HUMAN Zinc finger protein 704 OS=Homo sapiens OX=9606 GN=ZNF704 PE=1 SV=1
8	Q9ERQ3	3.97e-69	233	566	0.316	0.286	ZN704_MOUSE Zinc finger protein 704 OS=Mus musculus OX=10090 GN=Znf704 PE=1 SV=1
9	Q7TPT8	4.18e-40	143	128	0.160	0.641	Q7TPT8_MOUSE Zinc finger protein 395 OS=Mus musculus OX=10090 GN=Zfp395 PE=2 SV=1
10	A0A286YDB9	3.39e-34	126	101	0.140	0.713	A0A286YDB9_MOUSE Zinc finger protein 395 (Fragment) OS=Mus musculus OX=10090 GN=Zfp395 PE=1 SV=1
11	A0A286YDG8	1.35e-28	110	93	0.127	0.699	A0A286YDG8_MOUSE Zinc finger protein 395 (Fragment) OS=Mus musculus OX=10090 GN=Zfp395 PE=1 SV=1
12	Q9NR83	5.60e-18	88.2	387	0.125	0.165	S2A4R_HUMAN SLC2A4 regulator OS=Homo sapiens OX=9606 GN=SLC2A4RG PE=1 SV=4
13	P91943	0.001	43.9	751	0.027	0.019	PANG1_DROME Protein pangolin, isoforms A/H/I/S OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=1
14	A0A8I6A9A2	0.002	43.1	652	0.029	0.023	A0A8I6A9A2_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
15	A0A8I6AGH1	0.002	43.1	604	0.029	0.025	A0A8I6AGH1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
16	A0A8I6ARM6	0.002	43.5	581	0.029	0.026	A0A8I6ARM6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
17	Q8IMA8	0.002	43.5	1192	0.027	0.012	PANG2_DROME Protein pangolin, isoform J OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=2
18	D3Z9D1	0.003	42.7	598	0.025	0.022	D3Z9D1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=4
19	Q9NQB0	0.003	42.4	619	0.025	0.021	TF7L2_HUMAN Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2 PE=1 SV=2
20	B7WNT5	0.005	42.0	481	0.029	0.031	B7WNT5_HUMAN Transcription factor 7 OS=Homo sapiens OX=9606 GN=TCF7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15997 DUF4772	6.3e-27	105.9	Domain of unknown function (DUF4772)
2	PF16159 FOXP-CC	4.9	19.0	FOXP coiled-coil domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340494

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296504	0.775	Histone deacetylase complex subunit SAP30
2	9606.ENSP00000361930	0.721	14-3-3 protein beta/alpha
3	9606.ENSP00000316589	0.706	Ran-binding protein 10
4	9606.ENSP00000417291	0.679	Replication initiator 1
5	9606.ENSP00000292431	0.675	Nucleus accumbens-associated protein 1
6	9606.ENSP00000386433	0.601	Zinc finger protein 638
7	9606.ENSP00000362649	0.600	Histone deacetylase 1
8	9606.ENSP00000356448	0.574	Nucleoprotein TPR
9	9606.ENSP00000342118	0.546	HHIP-like protein 2
10	9606.ENSP00000456405	0.544	Target of rapamycin complex subunit LST8
11	9606.ENSP00000266987	0.540	RISC-loading complex subunit TARBP2
12	9606.ENSP00000320130	0.538	Cytoplasmic dynein 1 intermediate chain 1
13	9606.ENSP00000370532	0.537	Transcription factor IIIA
14	9606.ENSP00000296953	0.534	CREB3 regulatory factor
15	9606.ENSP00000216133	0.532	Chromobox protein homolog 7
16	9606.ENSP00000403932	0.517	EF-hand calcium-binding domain-containing protein 3
17	9606.ENSP00000386764	0.514	Zinc finger CCCH-type containing 6
18	9606.ENSP00000304769	0.508	Zinc finger protein 467
19	9606.ENSP00000359206	0.507	F-box/WD repeat-containing protein 1A
20	9606.ENSP00000265094	0.503	F-box/WD repeat-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0140110	0.990	transcription regulator activity
GO:0003700	0.981	DNA-binding transcription factor activity
GO:0000981	0.946	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.940	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.938	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005515	0.802	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.976	regulation of primary metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0006357	0.965	regulation of transcription by RNA polymerase II
GO:0048518	0.824	positive regulation of biological process
GO:0048522	0.688	positive regulation of cellular process
GO:0010604	0.651	positive regulation of macromolecule metabolic process
GO:0051173	0.643	positive regulation of nitrogen compound metabolic process
GO:0010557	0.540	positive regulation of macromolecule biosynthetic process
GO:0031328	0.515	positive regulation of cellular biosynthetic process
GO:0045893	0.511	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016604	0.925	nuclear body
GO:0016607	0.906	nuclear speck
GO:0032991	0.563	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]