StarFunc result for job id Q9H8T0

User Input

>input (292 residues)
MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAA
QSTNGTHASYGPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDG
VFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMY
ARRVFYKIDTASPLNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSP
WNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8T0	1.000	1.000	1.107E-54	292	1.000	1.000	Q9H8T0.pdb.gz	AKTIP_HUMAN AKT-interacting protein OS=Homo sapiens OX=9606 GN=AKTIP PE=1 SV=1
2	AFDB:Q7K4V4	0.631	0.751	5.043E-23	244	0.284	0.340	Q7K4V4.pdb.gz	AKTP1_DROME Protein crossbronx OS=Drosophila melanogaster OX=7227 GN=CG46338 PE=2 SV=1
3	AFDB:Q9LJD7	0.475	0.744	4.568E-11	182	0.140	0.225	Q9LJD7.pdb.gz	COP10_ARATH Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana OX=3702 GN=COP10 PE=1 SV=1
4	PDB:6cyrA	0.454	0.830	2.621E-10	153	0.123	0.235	6cyrA.pdb.gz
5	AFDB:O00762	0.470	0.740	4.244E-10	179	0.154	0.251	O00762.pdb.gz	UBE2C_HUMAN Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens OX=9606 GN=UBE2C PE=1 SV=1
6	AFDB:P52483	0.460	0.636	4.244E-10	207	0.140	0.198	P52483.pdb.gz	UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus OX=10090 GN=Ube2e3 PE=1 SV=2
7	AFDB:P52485	0.483	0.599	5.085E-10	232	0.137	0.172	P52485.pdb.gz	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1
8	AFDB:P28263	0.429	0.558	5.400E-10	218	0.144	0.193	P28263.pdb.gz	UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC8 PE=1 SV=2
9	AFDB:P51965	0.468	0.692	5.400E-10	193	0.099	0.150	P51965.pdb.gz	UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 PE=1 SV=1
10	PDB:3ptfA	0.470	0.859	5.736E-10	153	0.099	0.190	3ptfA.pdb.gz
11	AFDB:P42748	0.414	0.620	5.736E-10	187	0.123	0.193	P42748.pdb.gz	UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana OX=3702 GN=UBC4 PE=2 SV=2
12	AFDB:P42750	0.439	0.667	5.736E-10	183	0.130	0.208	P42750.pdb.gz	UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana OX=3702 GN=UBC6 PE=2 SV=2
13	PDB:6d68A	0.469	0.819	6.092E-10	159	0.120	0.220	6d68A.pdb.gz
14	PDB:2aakA	0.455	0.858	9.864E-10	150	0.106	0.207	2aakA.pdb.gz
15	PDB:4ddgA	0.457	0.340	2.747E-9	399	0.134	0.098	4ddgA.pdb.gz
16	PDB:7meyB	0.471	0.866	2.747E-9	153	0.127	0.242	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
17	PDB:2uczA	0.456	0.785	3.713E-9	164	0.123	0.220	2uczA.pdb.gz
18	PDB:6xodA	0.437	0.787	4.448E-9	154	0.110	0.208	6xodA.pdb.gz
19	PDB:4x57C	0.449	0.844	4.724E-9	149	0.110	0.215	4x57C.pdb.gz
20	PDB:5aieB	0.449	0.839	4.724E-9	150	0.092	0.180	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H8T0	0.0	605	292	1.000	1.000	AKTIP_HUMAN AKT-interacting protein OS=Homo sapiens OX=9606 GN=AKTIP PE=1 SV=1
2	Q7K4V4	8.20e-47	159	244	0.284	0.340	AKTP1_DROME Protein crossbronx OS=Drosophila melanogaster OX=7227 GN=CG46338 PE=2 SV=1
3	O00103	1.63e-09	58.2	176	0.140	0.233	UBC11_SCHPO Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc11 PE=3 SV=1
4	P49459	2.28e-06	48.9	152	0.120	0.230	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
5	Q9Z255	2.28e-06	48.9	152	0.120	0.230	UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus OX=10090 GN=Ube2a PE=1 SV=1
6	P28263	2.30e-06	49.7	218	0.103	0.138	UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC8 PE=1 SV=2
7	P25153	2.75e-06	48.5	151	0.137	0.265	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
8	Q7JW03	7.89e-06	47.8	183	0.123	0.197	Q7JW03_DROME CG2257 OS=Drosophila melanogaster OX=7227 GN=UbcE2H PE=1 SV=1
9	O74549	1.09e-05	47.4	177	0.116	0.192	UBC12_SCHPO NEDD8-conjugating enzyme ubc12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc12 PE=3 SV=1
10	P63146	2.60e-05	45.8	152	0.116	0.224	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
11	P63147	2.60e-05	45.8	152	0.116	0.224	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
12	P63149	2.60e-05	45.8	152	0.116	0.224	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
13	P06104	5.05e-05	45.1	172	0.120	0.203	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
14	P42748	7.68e-05	45.1	187	0.099	0.155	UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana OX=3702 GN=UBC4 PE=2 SV=2
15	P52490	1.05e-04	43.9	153	0.075	0.144	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
16	O74201	1.35e-04	43.9	179	0.123	0.201	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
17	P23566	2.40e-04	42.7	151	0.120	0.232	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
18	Q9LJD7	2.80e-04	43.1	182	0.123	0.198	COP10_ARATH Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana OX=3702 GN=COP10 PE=1 SV=1
19	P42749	7.03e-04	42.0	185	0.092	0.146	UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana OX=3702 GN=UBC5 PE=2 SV=2
20	P42750	0.001	41.6	183	0.120	0.191	UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana OX=3702 GN=UBC6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	6.3e-20	82.7	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001615

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000000652	0.916	Family with sequence similarity 160, member A2
2	60711.ENSCSAP00000011057	0.887	Hook microtubule-tethering protein 3
3	60711.ENSCSAP00000014727	0.855	Family with sequence similarity 160, member A1
4	60711.ENSCSAP00000016687	0.834	Hook microtubule-tethering protein 1
5	60711.ENSCSAP00000002866	0.828	Hook microtubule-tethering protein 2
6	60711.ENSCSAP00000007170	0.758	Adenylate cyclase 10 (soluble)
7	60711.ENSCSAP00000018096	0.756	RNA binding motif protein 12B
8	60711.ENSCSAP00000011787	0.703	Myosin IG
9	60711.ENSCSAP00000008506	0.640	Serine/threonine kinase 3
10	60711.ENSCSAP00000010402	0.640	Serine/threonine kinase 4
11	60711.ENSCSAP00000006204	0.624	annotation not available
12	60711.ENSCSAP00000006224	0.624	annotation not available
13	60711.ENSCSAP00000002494	0.618	Coronin, actin binding protein, 1A
14	60711.ENSCSAP00000003211	0.618	Coronin 6
15	60711.ENSCSAP00000004865	0.618	Coronin, actin binding protein, 1B
16	60711.ENSCSAP00000007240	0.618	Coronin, actin binding protein, 2A
17	60711.ENSCSAP00000009680	0.618	Coronin, actin binding protein, 2B
18	60711.ENSCSAP00000015172	0.618	Coronin, actin binding protein, 1C
19	60711.ENSCSAP00000001311	0.613	Myosin IA
20	60711.ENSCSAP00000002660	0.613	Myosin ID

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.997	catalytic activity, acting on a protein
GO:0016740	0.996	transferase activity
GO:0019787	0.991	ubiquitin-like protein transferase activity
GO:0004842	0.894	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0051179	0.989	localization
GO:0006810	0.983	transport
GO:0006996	0.982	organelle organization
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0050794	0.969	regulation of cellular process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0051649	0.965	establishment of localization in cell
GO:0046907	0.956	intracellular transport
GO:0031323	0.949	regulation of cellular metabolic process
GO:0016050	0.932	vesicle organization
GO:0010256	0.925	endomembrane system organization
GO:0048522	0.885	positive regulation of cellular process
GO:0033036	0.872	macromolecule localization
GO:0007032	0.871	endosome organization
GO:0051246	0.840	regulation of protein metabolic process
GO:0007034	0.816	vacuolar transport
GO:0070727	0.795	cellular macromolecule localization
GO:0065009	0.782	regulation of molecular function
GO:0031399	0.746	regulation of protein modification process
GO:0008104	0.722	protein localization
GO:0007041	0.681	lysosomal transport
GO:0071704	0.669	organic substance metabolic process
GO:0051174	0.639	regulation of phosphorus metabolic process
GO:0044238	0.637	primary metabolic process
GO:0006807	0.601	nitrogen compound metabolic process
GO:0044093	0.596	positive regulation of molecular function
GO:0043170	0.493	macromolecule metabolic process
GO:0007033	0.477	vacuole organization
GO:0016482	0.476	cytosolic transport
GO:0080171	0.464	lytic vacuole organization
GO:1901564	0.459	organonitrogen compound metabolic process
GO:0042325	0.454	regulation of phosphorylation
GO:0001932	0.428	regulation of protein phosphorylation
GO:0019538	0.422	protein metabolic process
GO:0009893	0.405	positive regulation of metabolic process
GO:0050896	0.391	response to stimulus
GO:0044237	0.378	cellular metabolic process
GO:0010604	0.372	positive regulation of macromolecule metabolic process
GO:0007040	0.351	lysosome organization
GO:0008333	0.346	endosome to lysosome transport
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0043412	0.318	macromolecule modification
GO:0031325	0.317	positive regulation of cellular metabolic process
GO:1905719	0.313	protein localization to perinuclear region of cytoplasm
GO:0051247	0.305	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.999	membrane
GO:0032991	0.998	protein-containing complex
GO:0005886	0.989	plasma membrane
GO:0005829	0.880	cytosol
GO:0043227	0.863	membrane-bounded organelle
GO:0098796	0.861	membrane protein complex
GO:0043229	0.859	intracellular organelle
GO:0099023	0.843	vesicle tethering complex
GO:0030897	0.825	HOPS complex
GO:0043231	0.813	intracellular membrane-bounded organelle
GO:0005634	0.746	nucleus
GO:0031981	0.345	nuclear lumen
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.996	Transferases.

[back to server]