StarFunc result for job id Q9H8W4

User Input

>input (249 residues)
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSD
DDDDDDSSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8W4	1.000	1.000	5.196E-50	249	1.000	1.000	Q9H8W4.pdb.gz	PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1
2	AFDB:O76902	0.865	0.684	1.920E-36	316	0.618	0.487	O76902.pdb.gz	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
3	AFDB:Q96S99	0.854	0.763	1.460E-34	279	0.554	0.495	Q96S99.pdb.gz	PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3
4	AFDB:P34657	0.850	0.796	2.079E-33	266	0.554	0.519	P34657.pdb.gz	YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans OX=6239 GN=ZK632.12 PE=1 SV=2
5	AFDB:Q54DW7	0.745	0.198	1.126E-22	986	0.373	0.094	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
6	AFDB:Q7Z6J4	0.726	0.289	2.336E-17	655	0.229	0.087	Q7Z6J4.pdb.gz	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
7	AFDB:Q8BY35	0.734	0.292	7.413E-17	655	0.229	0.087	Q8BY35.pdb.gz	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
8	AFDB:Q6ZNL6	0.433	0.079	1.321E-16	1462	0.237	0.040	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
9	AFDB:O88387	0.599	0.224	7.468E-16	766	0.205	0.067	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
10	AFDB:P98174	0.664	0.190	8.382E-16	961	0.249	0.065	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
11	PDB:7rx9A	0.441	0.262	5.165E-7	432	0.141	0.081	7rx9A.pdb.gz
12	PDB:4mt6A	0.428	0.284	5.202E-6	389	0.092	0.059	4mt6A.pdb.gz
13	PDB:5yqrA	0.356	0.333	6.944E-6	268	0.084	0.078	5yqrA.pdb.gz
14	PDB:6hhgA	0.328	0.218	1.853E-5	386	0.084	0.054	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:3ljuX	0.320	0.222	3.498E-5	373	0.080	0.054	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
16	PDB:6s9wA	0.324	0.203	7.410E-5	411	0.088	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:6bbpA	0.312	0.155	9.335E-5	520	0.133	0.063	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:6u3eA	0.318	0.205	9.890E-5	397	0.133	0.083	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:1lw3A	0.357	0.184	7.908E-4	513	0.048	0.023	1lw3A.pdb.gz
20	PDB:4mk0A	0.336	0.142	2.236E-3	631	0.096	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H8W4	0.0	520	249	1.000	1.000	PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1
2	O76902	1.05e-116	338	316	0.635	0.500	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
3	P34657	4.39e-101	296	266	0.538	0.504	YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans OX=6239 GN=ZK632.12 PE=1 SV=2
4	Q96S99	1.90e-97	288	279	0.514	0.459	PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3
5	Q54DW7	1.05e-32	127	986	0.353	0.089	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
6	Q7Z6J4	2.90e-19	88.6	655	0.213	0.081	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
7	Q49A55	3.20e-19	88.2	471	0.209	0.110	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
8	Q96M96	6.16e-19	87.8	766	0.209	0.068	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
9	Q8BY35	2.15e-18	86.3	655	0.229	0.087	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
10	Q91ZT5	9.10e-17	81.6	766	0.205	0.067	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
11	O88387	1.06e-16	81.3	766	0.201	0.065	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
12	P98174	1.42e-16	80.9	961	0.245	0.063	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
13	P52734	2.91e-16	80.1	960	0.261	0.068	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
14	A0A2X0SFF2	1.01e-14	75.5	1462	0.221	0.038	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
15	Q6ZNL6	1.01e-14	75.5	1462	0.221	0.038	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
16	B7ZM68	1.17e-14	75.5	1178	0.221	0.047	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
17	Q8WXA3	4.30e-14	73.6	606	0.133	0.054	RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3
18	Q960V6	7.49e-14	73.2	1343	0.141	0.026	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
19	Q7K9H6	7.85e-14	73.2	1343	0.141	0.026	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
20	Q96T51	2.88e-13	71.2	708	0.124	0.044	RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08874 DUF1835	2.5e+02	13.3	Domain of unknown function (DUF1835)
2	PF01363 FYVE	2.1e-15	67.9	FYVE zinc finger
3	PF02318 FYVE_2	3.4	19.3	FYVE-type zinc finger
4	PF16453 IQ_SEC7_PH	88	14.4	PH domain
5	PF00169 PH	2.2e-07	42.7	PH domain
6	PF16652 PH_13	3.9	18.8	Pleckstrin homology domain
7	PF19057 PH_19	3.1	18.9	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.955	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000264380	0.611	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000427424	0.519	Tumor necrosis factor alpha-induced protein 8
4	9606.ENSP00000378784	0.516	PHD finger protein 20 like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019899	0.419	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.960	biological regulation
GO:0071840	0.898	cellular component organization or biogenesis
GO:0051641	0.892	cellular localization
GO:0016043	0.890	cellular component organization
GO:0050789	0.860	regulation of biological process
GO:0050794	0.800	regulation of cellular process
GO:0016050	0.799	vesicle organization
GO:0010256	0.616	endomembrane system organization
GO:0051234	0.444	establishment of localization
GO:0006810	0.376	transport
GO:0016192	0.351	vesicle-mediated transport
GO:0048518	0.344	positive regulation of biological process
GO:0050896	0.328	response to stimulus
GO:0051649	0.302	establishment of localization in cell
GO:0019222	0.301	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0016020	0.862	membrane
GO:0030133	0.691	transport vesicle
GO:0005634	0.456	nucleus
GO:0005768	0.391	endosome
GO:0005829	0.326	cytosol
GO:0005773	0.309	vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]