StarFunc result for job id Q9H8X2

User Input

>input (491 residues)
MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGK
NVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTR
LQTYRFAEHRPILCVEIKPKCGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKY
CPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCKDARSPVADWSELAHHLKPF
FFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGTLSPGLGPQGPRVCEASPFSR
SLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQ
IDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKE
SEDCTLVLHKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8X2	1.000	1.000	5.545E-90	491	1.000	1.000	Q9H8X2.pdb.gz	IPPK_HUMAN Inositol-pentakisphosphate 2-kinase OS=Homo sapiens OX=9606 GN=IPPK PE=1 SV=1
2	AFDB:Q4JL91	0.867	0.880	3.231E-54	483	0.554	0.563	Q4JL91.pdb.gz	IPPK_DANRE Inositol-pentakisphosphate 2-kinase OS=Danio rerio OX=7955 GN=ippk PE=1 SV=3
3	AFDB:Q93YN9	0.711	0.771	3.688E-27	451	0.259	0.282	Q93YN9.pdb.gz	IPPK_ARATH Inositol-pentakisphosphate 2-kinase OS=Arabidopsis thaliana OX=3702 GN=IPK1 PE=1 SV=1
4	PDB:6fl3B	0.658	0.763	4.854E-26	420	0.261	0.305	6fl3B.pdb.gz	A Fluorescent Probe Identifies Active Site Ligands of Inositol Pentakisphosphate 2-Kinase.
5	PDB:4axdA	0.666	0.751	1.255E-25	433	0.259	0.293	4axdA.pdb.gz	Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
6	PDB:4lv7A	0.637	0.793	1.075E-23	390	0.244	0.308	4lv7A.pdb.gz	Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
7	AFDB:Q9W2Q7	0.423	0.338	2.265E-12	621	0.187	0.148	Q9W2Q7.pdb.gz	IPPK_DROME Inositol-pentakisphosphate 2-kinase OS=Drosophila melanogaster OX=7227 GN=Ipk1 PE=1 SV=2
8	AFDB:Q580D3	0.433	0.457	2.612E-9	461	0.149	0.158	Q580D3.pdb.gz	Q580D3_TRYB2 Inositol-pentakisphosphate 2-kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.410 PE=4 SV=1
9	AFDB:Q9WVS4	0.137	0.152	4.917E-2	420	0.088	0.102	Q9WVS4.pdb.gz	MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus OX=10090 GN=Mok PE=1 SV=1
10	AFDB:Q38BS3	0.140	0.171	7.711E-2	373	0.096	0.126	Q38BS3.pdb.gz	Q38BS3_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4250 PE=4 SV=1
11	PDB:4rgjA	0.126	0.132	1.306E-1	463	0.100	0.106	4rgjA.pdb.gz
12	AFDB:B3DMA2	0.099	0.070	1.633E-1	779	0.130	0.082	B3DMA2.pdb.gz	ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus OX=10116 GN=Acad11 PE=1 SV=1
13	AFDB:Q9UQ07	0.136	0.152	1.633E-1	419	0.100	0.117	Q9UQ07.pdb.gz	MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens OX=9606 GN=MOK PE=2 SV=1
14	AFDB:Q9U983	0.142	0.184	1.716E-1	335	0.096	0.140	Q9U983.pdb.gz	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
15	PDB:1obgA	0.139	0.197	1.854E-1	305	0.081	0.131	1obgA.pdb.gz	The Structure of Saicar Synthase: An Enzyme in the De Novo Pathway of Purine Nucleotide Biosynthesis
16	PDB:3eqdA	0.134	0.182	3.056E-1	315	0.092	0.143	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
17	PDB:4mk0A	0.152	0.128	7.151E-1	631	0.116	0.090	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:7eghA	0.107	0.087	8.309E-1	630	0.088	0.068	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
19	PDB:7qpgB	0.110	0.097	9.182E-1	591	0.098	0.081	7qpgB.pdb.gz
20	PDB:6k5lA	0.146	0.135	9.653E-1	565	0.067	0.058	6k5lA.pdb.gz	Characterization of metal binding of bifunctional kinase/phosphatase AceK and implication in activity modulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4JL91	0.0	551	483	0.556	0.565	IPPK_DANRE Inositol-pentakisphosphate 2-kinase OS=Danio rerio OX=7955 GN=ippk PE=1 SV=3
2	Q9H8X2	0.0	1024	491	1.000	1.000	IPPK_HUMAN Inositol-pentakisphosphate 2-kinase OS=Homo sapiens OX=9606 GN=IPPK PE=1 SV=1
3	Q93YN9	4.28e-23	103	451	0.167	0.182	IPPK_ARATH Inositol-pentakisphosphate 2-kinase OS=Arabidopsis thaliana OX=3702 GN=IPK1 PE=1 SV=1
4	Q9W2Q7	1.04e-16	85.1	621	0.167	0.132	IPPK_DROME Inositol-pentakisphosphate 2-kinase OS=Drosophila melanogaster OX=7227 GN=Ipk1 PE=1 SV=2
5	Q9Y573	0.14	37.4	584	0.063	0.053	IPP_HUMAN Actin-binding protein IPP OS=Homo sapiens OX=9606 GN=IPP PE=1 SV=1
6	P60322	3.0	31.6	136	0.063	0.228	NANO2_MOUSE Nanos homolog 2 OS=Mus musculus OX=10090 GN=Nanos2 PE=1 SV=2
7	Q385W2	3.9	32.3	299	0.026	0.043	Q385W2_TRYB2 DUF4200 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2130 PE=4 SV=1
8	Q7JR58	5.6	31.6	295	0.024	0.041	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
9	Q26307	8.8	31.2	474	0.033	0.034	ANA_DROME Protein anachronism OS=Drosophila melanogaster OX=7227 GN=ana PE=2 SV=2
10	Q9ZQG9	9.4	31.2	392	0.041	0.051	E1314_ARATH Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana OX=3702 GN=At2g27500 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06090 Ins_P5_2-kin	2.3e-94	328.3	Inositol-pentakisphosphate 2-kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363046	0.987	Inositol polyphosphate multikinase
2	9606.ENSP00000400887	0.981	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
3	9606.ENSP00000267615	0.978	Inositol-tetrakisphosphate 1-kinase
4	9606.ENSP00000331103	0.970	Inositol hexakisphosphate kinase 2
5	9606.ENSP00000482032	0.970	Inositol hexakisphosphate kinase 1
6	9606.ENSP00000398861	0.963	Inositol hexakisphosphate kinase 3
7	9606.ENSP00000482907	0.955	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
8	9606.ENSP00000308622	0.786	Nucleoporin GLE1
9	9606.ENSP00000441140	0.734	Nucleolar protein 8
10	9606.ENSP00000347188	0.724	BTB/POZ domain-containing protein KCTD6
11	9606.ENSP00000364737	0.621	Centromere protein P
12	9606.ENSP00000439170	0.614	Tubulin-specific chaperone E
13	9606.ENSP00000288071	0.596	ATP-dependent RNA helicase DDX19B
14	9606.ENSP00000414359	0.557	Proteasome subunit alpha type-1
15	9606.ENSP00000253577	0.548	ATP-binding cassette sub-family B member 7, mitochondrial
16	9606.ENSP00000420315	0.538	Monoacylglycerol lipase ABHD6
17	9606.ENSP00000219789	0.523	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
18	9606.ENSP00000411152	0.520	Inositol-trisphosphate 3-kinase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0005515	1.000	protein binding
GO:0035299	1.000	inositol pentakisphosphate 2-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0050794	0.955	regulation of cellular process
GO:0043647	0.931	inositol phosphate metabolic process
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0080090	0.918	regulation of primary metabolic process
GO:0006356	0.893	regulation of transcription by RNA polymerase I
GO:0048518	0.869	positive regulation of biological process
GO:0048522	0.862	positive regulation of cellular process
GO:0140747	0.841	regulation of ncRNA transcription
GO:0031325	0.739	positive regulation of cellular metabolic process
GO:0010604	0.738	positive regulation of macromolecule metabolic process
GO:0009891	0.734	positive regulation of biosynthetic process
GO:0045943	0.715	positive regulation of transcription by RNA polymerase I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0005654	0.997	nucleoplasm
GO:0005730	0.985	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20313	1.000	1D-myo-inositol 1,3,4,5,6-pentakisphosphate + ATP = 1D-myo-inositol hexakisphosphate + ADP + H(+)
EC:2.7.1.158	1.000	inositol-pentakisphosphate 2-kinase.

[back to server]