StarFunc result for job id Q9H8X9

User Input

>input (412 residues)
MDTRSGSQCSVTPEAILNNEKLVLPPRISRVNGWSLPLHYFQVVTWAVFVGLSSATFGIF
IPFLPHAWKYIAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAH
VIQNQFCHLCKVTVNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAG
MLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLV
LLLDFLGLVHLGQLLIFHIYLKAKKMTTFEYLINNRKEESSKHQAVRKDPYVQMDKGVLQ
QGAGALGSSAQGVKAKSSLLIHKHLCHFCTSVNQDGDSTAREGDEDPCPSALGAKARNSR
LICRRLCQFSTRVHPDGGSMAQEADDAPSISTLGLQQETTEPMKTDSAESED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8X9	1.000	1.000	2.969E-69	412	1.000	1.000	Q9H8X9.pdb.gz	ZDH11_HUMAN Palmitoyltransferase ZDHHC11 OS=Homo sapiens OX=9606 GN=ZDHHC11 PE=1 SV=1
2	AFDB:Q14AK4	0.645	0.765	8.590E-36	347	0.427	0.507	Q14AK4.pdb.gz	ZDH11_MOUSE Palmitoyltransferase ZDHHC11 OS=Mus musculus OX=10090 GN=Zdhhc11 PE=1 SV=2
3	AFDB:Q8R0N9	0.630	0.539	1.092E-31	484	0.347	0.295	Q8R0N9.pdb.gz	ZDHC1_MOUSE Palmitoyltransferase ZDHHC1 OS=Mus musculus OX=10090 GN=Zdhhc1 PE=1 SV=2
4	AFDB:Q8WTX9	0.611	0.521	2.249E-31	485	0.364	0.309	Q8WTX9.pdb.gz	ZDHC1_HUMAN Palmitoyltransferase ZDHHC1 OS=Homo sapiens OX=9606 GN=ZDHHC1 PE=1 SV=1
5	AFDB:Q9VPM2	0.570	0.252	2.713E-20	968	0.284	0.121	Q9VPM2.pdb.gz	Q9VPM2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17075 PE=4 SV=1
6	AFDB:Q57WF0	0.511	0.586	2.761E-16	357	0.197	0.227	Q57WF0.pdb.gz	Q57WF0_TRYB2 Palmitoyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.730 PE=3 SV=1
7	AFDB:Q8IZN3	0.409	0.348	1.192E-11	488	0.209	0.176	Q8IZN3.pdb.gz	ZDH14_HUMAN Palmitoyltransferase ZDHHC14 OS=Homo sapiens OX=9606 GN=ZDHHC14 PE=1 SV=1
8	PDB:6bmsD	0.397	0.572	8.976E-7	282	0.104	0.152	6bmsD.pdb.gz	Fatty acyl recognition and transfer by an integral membraneS-acyltransferase.
9	AFDB:Q969W1	0.375	0.407	1.253E-6	377	0.141	0.154	Q969W1.pdb.gz	ZDH16_HUMAN Palmitoyltransferase ZDHHC16 OS=Homo sapiens OX=9606 GN=ZDHHC16 PE=1 SV=1
10	AFDB:Q01231	0.132	0.147	1.392E-1	358	0.090	0.103	Q01231.pdb.gz	CXA5_MOUSE Gap junction alpha-5 protein OS=Mus musculus OX=10090 GN=Gja5 PE=2 SV=2
11	AFDB:A0A0A7MA29	0.106	0.096	3.032E-1	472	0.104	0.091	A0A0A7MA29.pdb.gz	A0A0A7MA29_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 PE=2 SV=1
12	PDB:6l3tA	0.124	0.234	1.796	201	0.049	0.100	6l3tA.pdb.gz	Cryo-EM structure of human Cx31.3/GJC3 connexin hemichannel.
13	PDB:7d5sB2	0.091	0.052	2.243	851	0.041	0.020	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:7r5jV0	0.101	0.122	2.801	273	0.080	0.121	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:2zdiB	0.104	0.352	3.131	106	0.039	0.151	2zdiB.pdb.gz
16	PDB:7jjpA	0.115	0.215	3.310	196	0.032	0.066	7jjpA.pdb.gz
17	PDB:4n78F	0.130	0.281	4.884	156	0.036	0.096	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
18	PDB:7e2xR	0.086	0.119	4.884	278	0.061	0.090	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
19	PDB:7jkcA	0.111	0.209	5.459	196	0.036	0.077	7jkcA.pdb.gz
20	PDB:7f92A	0.113	0.215	6.100	196	0.027	0.056	7f92A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H8X9	0.0	861	412	1.000	1.000	ZDH11_HUMAN Palmitoyltransferase ZDHHC11 OS=Homo sapiens OX=9606 GN=ZDHHC11 PE=1 SV=1
2	Q14AK4	1.13e-124	366	347	0.425	0.504	ZDH11_MOUSE Palmitoyltransferase ZDHHC11 OS=Mus musculus OX=10090 GN=Zdhhc11 PE=1 SV=2
3	Q8R0N9	4.41e-78	251	484	0.306	0.260	ZDHC1_MOUSE Palmitoyltransferase ZDHHC1 OS=Mus musculus OX=10090 GN=Zdhhc1 PE=1 SV=2
4	Q8WTX9	9.80e-77	248	485	0.330	0.280	ZDHC1_HUMAN Palmitoyltransferase ZDHHC1 OS=Homo sapiens OX=9606 GN=ZDHHC1 PE=1 SV=1
5	Q9VPM2	1.60e-39	153	968	0.172	0.073	Q9VPM2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17075 PE=4 SV=1
6	Q2XXY4	1.77e-39	152	939	0.172	0.076	Q2XXY4_DROME CG17075 (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG17075 PE=4 SV=1
7	Q6DR03	5.64e-29	120	565	0.235	0.172	ZDHC3_ARATH Protein S-acyltransferase 21 OS=Arabidopsis thaliana OX=3702 GN=PAT21 PE=2 SV=1
8	Q57WF0	1.48e-21	97.4	357	0.187	0.216	Q57WF0_TRYB2 Palmitoyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.730 PE=3 SV=1
9	Q385E7	9.36e-19	90.5	578	0.124	0.088	Q385E7_TRYB2 Palmitoyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4090 PE=3 SV=1
10	Q2THW6	3.70e-16	82.8	762	0.143	0.077	Q2THW6_RAT Palmitoyltransferase OS=Rattus norvegicus OX=10116 GN=Zdhhc8 PE=2 SV=1
11	Q5Y5T5	3.73e-16	82.8	762	0.143	0.077	ZDHC8_MOUSE Palmitoyltransferase ZDHHC8 OS=Mus musculus OX=10090 GN=Zdhhc8 PE=1 SV=1
12	Q9ULC8	3.74e-16	82.8	765	0.143	0.077	ZDHC8_HUMAN Palmitoyltransferase ZDHHC8 OS=Homo sapiens OX=9606 GN=ZDHHC8 PE=1 SV=3
13	A0A8I6A4S3	4.61e-16	82.4	733	0.136	0.076	A0A8I6A4S3_RAT Palmitoyltransferase OS=Rattus norvegicus OX=10116 GN=Zdhhc8 PE=3 SV=1
14	Q0WQK2	2.09e-15	79.7	443	0.102	0.095	ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=PAT07 PE=1 SV=1
15	Q9M1K5	1.71e-14	77.4	477	0.129	0.111	ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=PAT04 PE=2 SV=1
16	Q8VDZ4	8.41e-14	75.5	715	0.150	0.087	ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus OX=10090 GN=Zdhhc5 PE=1 SV=1
17	Q9C0B5	9.53e-14	75.5	715	0.150	0.087	ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2
18	Q2THW7	9.79e-14	75.5	715	0.150	0.087	ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus OX=10116 GN=Zdhhc5 PE=1 SV=1
19	Q9NUE0	1.46e-13	73.9	388	0.119	0.126	ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens OX=9606 GN=ZDHHC18 PE=1 SV=2
20	Q9SB58	1.60e-13	73.9	407	0.104	0.106	ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=PAT08 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01529 DHHC	3.7e-25	100.0	DHHC palmitoyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323549	0.530	Sodium-dependent neutral amino acid transporter B(0)AT3
2	9606.ENSP00000400113	0.526	Palmitoyltransferase ZDHHC13
3	9606.ENSP00000392368	0.502	Uncharacterized protein CCDC198

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035591	1.000	signaling adaptor activity
GO:0016409	0.997	palmitoyltransferase activity
GO:0140096	0.948	catalytic activity, acting on a protein
GO:0016417	0.939	S-acyltransferase activity
GO:0019706	0.920	protein-cysteine S-palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.948	response to stimulus
GO:0006950	0.932	response to stress
GO:0044419	0.930	biological process involved in interspecies interaction between organisms
GO:0050789	0.925	regulation of biological process
GO:0002230	0.844	positive regulation of defense response to virus by host
GO:0140374	0.843	antiviral innate immune response
GO:0009987	0.584	cellular process
GO:0071704	0.446	organic substance metabolic process
GO:0044238	0.446	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005794	0.991	Golgi apparatus
GO:0098588	0.985	bounding membrane of organelle
GO:0005783	0.977	endoplasmic reticulum
GO:0000139	0.922	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.997	Transferring groups other than amino-acyl groups.
RHEA:36683	0.920	hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]
EC:2.3.1.225	0.920	protein S-acyltransferase.

[back to server]