StarFunc result for job id Q9H900

User Input

>input (591 residues)
MWERLNCAAEDFYSRLLQKFNEEKKGIRKDPFLYEADVQVQLISKGQPNPLKNILNENDI
VFIVEKVPLEKEETSHIEELQSEETAISDFSTGENVGPLALPVGKARQLIGLYTMAHNPN
MTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSV
NLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQI
PPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQ
EFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSV
ISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQML
LEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPF
IKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQK
KIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H900	1.000	1.000	0.000	591	1.000	1.000	Q9H900.pdb.gz	ZWILC_HUMAN Protein zwilch homolog OS=Homo sapiens OX=9606 GN=ZWILCH PE=1 SV=2
2	PDB:7qpgB	0.968	0.968	8.863E-89	591	1.000	1.000	7qpgB.pdb.gz
3	AFDB:Q95XP9	0.654	0.619	1.211E-22	630	0.178	0.167	Q95XP9.pdb.gz	ZWILC_CAEEL Protein zwilch homolog OS=Caenorhabditis elegans OX=6239 GN=zwl-1 PE=1 SV=1
4	AFDB:Q9VA00	0.594	0.553	5.752E-21	641	0.174	0.161	Q9VA00.pdb.gz	ZWILC_DROME Protein zwilch OS=Drosophila melanogaster OX=7227 GN=Zwilch PE=1 SV=1
5	AFDB:Q15042	0.380	0.250	1.355E-5	981	0.152	0.092	Q15042.pdb.gz	RB3GP_HUMAN Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3
6	PDB:6h03A	0.107	0.067	5.194E-2	1223	0.085	0.041	6h03A.pdb.gz
7	AFDB:Q9NHF6	0.063	0.090	1.598E-1	354	0.096	0.161	Q9NHF6.pdb.gz	Q9NHF6_DICDI Dynacortin OS=Dictyostelium discoideum OX=44689 GN=dct PE=2 SV=1
8	AFDB:Q22942	0.090	0.106	2.510E-1	429	0.083	0.114	Q22942.pdb.gz	CKA2_CAEEL Choline kinase A2 OS=Caenorhabditis elegans OX=6239 GN=cka-2 PE=1 SV=2
9	PDB:2ig7B	0.085	0.120	2.584E-1	342	0.056	0.096	2ig7B.pdb.gz
10	PDB:4xmmE	0.078	0.060	3.670E-1	896	0.073	0.048	4xmmE.pdb.gz
11	PDB:6wvgA	0.065	0.079	3.670E-1	443	0.086	0.115	6wvgA.pdb.gz
12	AFDB:P06784	0.087	0.096	4.356E-1	515	0.130	0.150	P06784.pdb.gz	STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE7 PE=1 SV=1
13	AFDB:Q5PP23	0.085	0.087	4.356E-1	562	0.078	0.082	Q5PP23.pdb.gz	FLY1_ARATH Transmembrane E3 ubiquitin-protein ligase FLY1 OS=Arabidopsis thaliana OX=3702 GN=FLY1 PE=1 SV=1
14	PDB:7bouA	0.070	0.077	4.958E-1	525	0.054	0.061	7bouA.pdb.gz
15	AFDB:O54804	0.078	0.095	5.064E-1	453	0.093	0.121	O54804.pdb.gz	CHKA_MOUSE Choline kinase alpha OS=Mus musculus OX=10090 GN=Chka PE=1 SV=3
16	PDB:3axjB	0.079	0.161	5.763E-1	240	0.051	0.125	3axjB.pdb.gz
17	AFDB:A0A1D8PD58	0.072	0.074	6.188E-1	563	0.085	0.089	A0A1D8PD58.pdb.gz	A0A1D8PD58_CANAL Globin family profile domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C103870CA PE=3 SV=1
18	PDB:2ygkA	0.060	0.100	6.371E-1	319	0.036	0.066	2ygkA.pdb.gz	Structural and Functional Insights Into DNA-End Processing by the Archaeal Hera Helicase-Nura Nuclease Complex.
19	PDB:6wvdA	0.069	0.094	6.371E-1	397	0.073	0.108	6wvdA.pdb.gz
20	PDB:7pt68	0.088	0.112	6.371E-1	402	0.096	0.142	7pt68.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H900	0.0	1219	591	1.000	1.000	ZWILC_HUMAN Protein zwilch homolog OS=Homo sapiens OX=9606 GN=ZWILCH PE=1 SV=2
2	Q95XP9	2.49e-06	52.8	630	0.120	0.113	ZWILC_CAEEL Protein zwilch homolog OS=Caenorhabditis elegans OX=6239 GN=zwl-1 PE=1 SV=1
3	Q9N3W9	0.16	37.4	467	0.036	0.045	Q9N3W9_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-71 PE=4 SV=2
4	Q9VBX1	1.1	35.0	992	0.039	0.023	NEMF_DROME Ribosome quality control complex subunit NEMF homolog OS=Drosophila melanogaster OX=7227 GN=Clbn PE=1 SV=2
5	Q01279	2.3	33.9	1210	0.047	0.023	EGFR_MOUSE Epidermal growth factor receptor OS=Mus musculus OX=10090 GN=Egfr PE=1 SV=1
6	Q9VKV2	2.5	33.5	950	0.046	0.028	Q9VKV2_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManI PE=3 SV=1
7	Q5IRA7	3.5	32.7	283	0.056	0.117	Q5IRA7_DANRE Stanniocalcin OS=Danio rerio OX=7955 GN=zgc:136650 PE=2 SV=1
8	Q9HBH9	3.8	32.7	465	0.039	0.049	MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MKNK2 PE=1 SV=3
9	Q96Q15	4.4	33.1	3661	0.063	0.010	SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1 PE=1 SV=3
10	J3KRA9	4.5	33.1	3551	0.063	0.010	J3KRA9_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=SMG1 PE=1 SV=1
11	Q8BKX6	4.9	32.7	3658	0.063	0.010	SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus OX=10090 GN=Smg1 PE=1 SV=3
12	F4JIF4	7.7	32.0	1710	0.024	0.008	NET1B_ARATH Protein NETWORKED 1B OS=Arabidopsis thaliana OX=3702 GN=NET1B PE=2 SV=1
13	P0A7D4	8.0	32.0	432	0.039	0.053	PURA_ECOLI Adenylosuccinate synthetase OS=Escherichia coli (strain K12) OX=83333 GN=purA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04901 RAMP	3.4e+02	12.7	Receptor activity modifying family
2	PF09817 Zwilch	2.9e-202	684.8	RZZ complex, subunit zwilch

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311429

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000200135	0.999	Centromere/kinetochore protein zw10 homolog
2	9606.ENSP00000328236	0.999	Kinetochore-associated protein 1
3	9606.ENSP00000261597	0.972	Kinetochore protein NDC80 homolog
4	9606.ENSP00000265148	0.950	Centromere-associated protein E
5	9606.ENSP00000302530	0.948	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000296509	0.941	Mitotic spindle assembly checkpoint protein MAD2A
7	9606.ENSP00000287598	0.937	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
8	9606.ENSP00000363055	0.928	ZW10 interactor
9	9606.ENSP00000265295	0.920	Protein Spindly
10	9606.ENSP00000361540	0.892	Cell division cycle protein 20 homolog
11	9606.ENSP00000260731	0.885	Kinesin-like protein KIF11
12	9606.ENSP00000335463	0.866	Kinetochore scaffold 1
13	9606.ENSP00000378295	0.860	Inner centromere protein
14	9606.ENSP00000362146	0.850	Borealin
15	9606.ENSP00000306999	0.838	N-acetyltransferase ESCO2
16	9606.ENSP00000271452	0.837	Kinetochore protein Nuf2
17	9606.ENSP00000358813	0.829	Dual specificity protein kinase TTK
18	9606.ENSP00000362018	0.818	Centromere protein I
19	9606.ENSP00000240423	0.815	Condensin complex subunit 2
20	9606.ENSP00000313950	0.812	Aurora kinase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.357	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0007346	0.981	regulation of mitotic cell cycle
GO:1901987	0.981	regulation of cell cycle phase transition
GO:1903047	0.979	mitotic cell cycle process
GO:0033043	0.977	regulation of organelle organization
GO:0051641	0.968	cellular localization
GO:0048523	0.959	negative regulation of cellular process
GO:1901990	0.958	regulation of mitotic cell cycle phase transition
GO:0033044	0.957	regulation of chromosome organization
GO:0051716	0.956	cellular response to stimulus
GO:0000075	0.949	cell cycle checkpoint signaling
GO:0045930	0.947	negative regulation of mitotic cell cycle
GO:0007088	0.947	regulation of mitotic nuclear division
GO:0033045	0.946	regulation of sister chromatid segregation
GO:0007093	0.936	mitotic cell cycle checkpoint signaling
GO:1901991	0.934	negative regulation of mitotic cell cycle phase transition
GO:0010639	0.898	negative regulation of organelle organization
GO:0034502	0.888	protein localization to chromosome
GO:0030071	0.865	regulation of mitotic metaphase/anaphase transition
GO:0033047	0.857	regulation of mitotic sister chromatid segregation
GO:0045841	0.849	negative regulation of mitotic metaphase/anaphase transition
GO:0007094	0.844	mitotic spindle assembly checkpoint signaling
GO:0071459	0.799	protein localization to chromosome, centromeric region
GO:0034501	0.758	protein localization to kinetochore
GO:0071840	0.306	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0000776	0.999	kinetochore
GO:0005654	0.967	nucleoplasm
GO:1990423	0.767	RZZ complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]