StarFunc result for job id Q9H902

User Input

>input (201 residues)
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC
WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVH
FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASG
KHGQPKMSRSASESASSSGTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGH4	0.899	0.899	3.734E-27	201	0.980	0.980	Q8BGH4.pdb.gz	REEP1_MOUSE Receptor expression-enhancing protein 1 OS=Mus musculus OX=10090 GN=Reep1 PE=1 SV=1
2	AFDB:Q8VCD6	0.675	0.545	3.554E-19	254	0.687	0.543	Q8VCD6.pdb.gz	REEP2_MOUSE Receptor expression-enhancing protein 2 OS=Mus musculus OX=10090 GN=Reep2 PE=1 SV=2
3	AFDB:Q9H6H4	0.672	0.540	2.834E-18	257	0.627	0.490	Q9H6H4.pdb.gz	REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1
4	AFDB:Q6AZM3	0.688	0.543	4.402E-18	261	0.607	0.467	Q6AZM3.pdb.gz	REEP4_XENLA Receptor expression-enhancing protein 4 OS=Xenopus laevis OX=8355 GN=reep4 PE=1 SV=1
5	AFDB:Q6NUK4	0.673	0.545	1.757E-17	255	0.627	0.494	Q6NUK4.pdb.gz	REEP3_HUMAN Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1
6	AFDB:A0A0B4LG73	0.659	0.435	4.294E-14	312	0.483	0.311	A0A0B4LG73.pdb.gz	A0A0B4LG73_DROME Receptor expression-enhancing protein OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
7	AFDB:Q8SX60	0.555	0.267	7.472E-12	435	0.428	0.198	Q8SX60.pdb.gz	Q8SX60_DROME LD42159p OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
8	AFDB:A0A0B4JCU3	0.519	0.169	9.255E-11	716	0.458	0.128	A0A0B4JCU3.pdb.gz	A0A0B4JCU3_DROME Receptor expression enhancing protein A, isoform I OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
9	AFDB:A0A509ADH4	0.404	0.366	2.984E-6	226	0.224	0.199	A0A509ADH4.pdb.gz	YOP1_PLABA Protein YOP1 homolog OS=Plasmodium berghei (strain Anka) OX=5823 GN=YOP1 PE=1 SV=1
10	AFDB:Q9N4G8	0.427	0.460	9.861E-6	183	0.184	0.202	Q9N4G8.pdb.gz	Q9N4G8_CAEEL Receptor expression-enhancing protein OS=Caenorhabditis elegans OX=6239 GN=yop-1 PE=1 SV=1
11	PDB:1kkcA	0.140	0.141	4.911	200	0.025	0.025	1kkcA.pdb.gz	Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
12	PDB:3iqcA	0.176	0.275	5.230	119	0.075	0.126	3iqcA.pdb.gz
13	PDB:6w2xB	0.229	0.091	6.726	669	0.070	0.021	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
14	PDB:6uwmA	0.209	0.195	7.628	221	0.109	0.100	6uwmA.pdb.gz
15	PDB:6ytvA	0.133	0.110	8.123	252	0.070	0.056	6ytvA.pdb.gz
16	PDB:6cnnA	0.143	0.086	9.811	360	0.060	0.033	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H902	1.43e-148	412	201	1.000	1.000	REEP1_HUMAN Receptor expression-enhancing protein 1 OS=Homo sapiens OX=9606 GN=REEP1 PE=1 SV=1
2	Q8BGH4	4.03e-146	406	201	0.980	0.980	REEP1_MOUSE Receptor expression-enhancing protein 1 OS=Mus musculus OX=10090 GN=Reep1 PE=1 SV=1
3	Q8VCD6	1.12e-89	265	254	0.652	0.516	REEP2_MOUSE Receptor expression-enhancing protein 2 OS=Mus musculus OX=10090 GN=Reep2 PE=1 SV=2
4	Q9BRK0	9.29e-86	255	252	0.657	0.524	REEP2_HUMAN Receptor expression-enhancing protein 2 OS=Homo sapiens OX=9606 GN=REEP2 PE=1 SV=2
5	Q6NUK4	7.26e-84	250	255	0.632	0.498	REEP3_HUMAN Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1
6	Q6AZM3	4.80e-81	243	261	0.577	0.444	REEP4_XENLA Receptor expression-enhancing protein 4 OS=Xenopus laevis OX=8355 GN=reep4 PE=1 SV=1
7	Q9H6H4	1.60e-80	242	257	0.602	0.471	REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1
8	A0A0B4LG73	4.93e-66	207	312	0.468	0.301	A0A0B4LG73_DROME Receptor expression-enhancing protein OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
9	A0A0B4JCV3	6.47e-64	208	538	0.468	0.175	A0A0B4JCV3_DROME Receptor expression enhancing protein A, isoform P OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
10	A0A0B4JD87	8.43e-64	208	570	0.468	0.165	A0A0B4JD87_DROME Receptor expression enhancing protein A, isoform J OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
11	A0A0B4JD44	9.29e-64	208	569	0.468	0.165	A0A0B4JD44_DROME Receptor expression enhancing protein A, isoform H OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
12	Q7JRH2	1.93e-60	192	288	0.428	0.299	Q7JRH2_DROME Receptor expression-enhancing protein OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
13	A0A0B4LG90	3.75e-59	193	459	0.443	0.194	A0A0B4LG90_DROME Receptor expression enhancing protein A, isoform R OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
14	A0A0B4LH91	1.05e-57	194	685	0.443	0.130	A0A0B4LH91_DROME Receptor expression enhancing protein A, isoform Q OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
15	A0A0B4JCU3	9.09e-57	192	716	0.443	0.124	A0A0B4JCU3_DROME Receptor expression enhancing protein A, isoform I OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
16	A0A0B4KEX8	8.11e-55	177	291	0.403	0.278	A0A0B4KEX8_DROME Receptor expression-enhancing protein OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
17	Q8SX60	4.92e-54	179	435	0.403	0.186	Q8SX60_DROME LD42159p OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
18	E2QRG8	3.62e-24	95.5	165	0.204	0.248	E2QRG8_HUMAN Receptor expression-enhancing protein (Fragment) OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=1
19	Q00765	4.75e-24	95.9	189	0.204	0.217	REEP5_HUMAN Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3
20	Q60870	2.30e-23	94.0	185	0.194	0.211	REEP5_MOUSE Receptor expression-enhancing protein 5 OS=Mus musculus OX=10090 GN=Reep5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03134 TB2_DP1_HVA22	5.8e-23	92.0	TB2/DP1, HVA22 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000020845

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000046065	0.738	Uncharacterized protein
2	9598.ENSPTRP00000020280	0.735	Spastin
3	9598.ENSPTRP00000027052	0.702	Receptor (chemosensory) transporter protein 1
4	9598.ENSPTRP00000045318	0.695	Receptor (chemosensory) transporter protein 2
5	9598.ENSPTRP00000056915	0.689	May be involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells
6	9598.ENSPTRP00000006499	0.669	Berardinelli-Seip congenital lipodystrophy 2 (Seipin)
7	9598.ENSPTRP00000054695	0.637	Reticulon-4
8	9598.ENSPTRP00000006545	0.635	Uncharacterized protein
9	9598.ENSPTRP00000002586	0.617	Uncharacterized protein
10	9598.ENSPTRP00000013352	0.612	ADP-ribosylation factor-like 6 interacting protein 1
11	9598.ENSPTRP00000005861	0.607	AMP deaminase
12	9598.ENSPTRP00000029566	0.600	Catenin (Cadherin-associated protein), alpha 1, 102kDa
13	9598.ENSPTRP00000006551	0.592	Reticulon
14	9598.ENSPTRP00000053044	0.588	KIAA0196
15	9598.ENSPTRP00000009640	0.561	Uncharacterized protein
16	9598.ENSPTRP00000016795	0.558	Guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
17	9598.ENSPTRP00000031975	0.556	Uncharacterized protein
18	9598.ENSPTRP00000004870	0.553	Delta-1-pyrroline-5-carboxylate synthase
19	9598.ENSPTRP00000021370	0.548	Uncharacterized protein
20	9598.ENSPTRP00000008740	0.547	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.965	biological regulation
GO:0071840	0.955	cellular component organization or biogenesis
GO:0016043	0.954	cellular component organization
GO:0050789	0.910	regulation of biological process
GO:0051179	0.855	localization
GO:0051234	0.831	establishment of localization
GO:0008104	0.822	protein localization
GO:0072657	0.795	protein localization to membrane
GO:0007029	0.789	endoplasmic reticulum organization
GO:0050794	0.778	regulation of cellular process
GO:0045184	0.763	establishment of protein localization
GO:0090150	0.742	establishment of protein localization to membrane
GO:0051205	0.714	protein insertion into membrane
GO:0032879	0.611	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.883	organelle membrane
GO:0098827	0.549	endoplasmic reticulum subcompartment
GO:0042175	0.493	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.448	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]