StarFunc result for job id Q9H903

User Input

>input (347 residues)
MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMA
KHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPK
DVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLC
LDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDA
TVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGK
TKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H903	1.000	1.000	1.051E-69	347	1.000	1.000	Q9H903.pdb.gz	MTD2L_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2L PE=1 SV=3
2	AFDB:D3ZUA0	0.907	0.931	3.983E-63	338	0.862	0.885	D3ZUA0.pdb.gz	MTD2L_RAT Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mthfd2l PE=1 SV=1
3	AFDB:P13995	0.866	0.858	1.727E-55	350	0.651	0.646	P13995.pdb.gz	MTDC_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2
4	PDB:6s4fB	0.852	0.991	3.176E-49	298	0.625	0.728	6s4fB.pdb.gz	Pharmacological targeting of MTHFD2 suppresses acute myeloid leukemia by inducing thymidine depletion and replication stress.
5	AFDB:P09440	0.808	0.294	9.770E-37	975	0.395	0.141	P09440.pdb.gz	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
6	AFDB:P54382	0.792	0.967	3.712E-36	283	0.392	0.481	P54382.pdb.gz	FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) OX=224308 GN=folD PE=1 SV=1
7	AFDB:O65271	0.776	0.749	1.256E-35	360	0.432	0.417	O65271.pdb.gz	FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLD4 PE=1 SV=1
8	AFDB:Q9LHH7	0.809	0.935	9.574E-35	299	0.380	0.441	Q9LHH7.pdb.gz	FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana OX=3702 GN=FOLD2 PE=2 SV=1
9	AFDB:P24186	0.783	0.941	2.036E-34	288	0.383	0.462	P24186.pdb.gz	FOLD_ECOLI Bifunctional protein FolD OS=Escherichia coli (strain K12) OX=83333 GN=folD PE=1 SV=4
10	AFDB:O96553	0.798	0.292	4.862E-34	968	0.375	0.134	O96553.pdb.gz	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
11	AFDB:O43007	0.810	0.295	7.299E-34	972	0.375	0.134	O43007.pdb.gz	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
12	PDB:4cjxA	0.798	0.929	2.141E-33	297	0.372	0.434	4cjxA.pdb.gz	Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
13	PDB:1b0aA	0.775	0.932	1.763E-31	287	0.383	0.463	1b0aA.pdb.gz
14	PDB:2c2xA	0.762	0.937	1.006E-30	280	0.337	0.418	2c2xA.pdb.gz
15	PDB:4a26A	0.767	0.893	4.819E-30	296	0.375	0.439	4a26A.pdb.gz
16	PDB:1ee9A	0.680	0.741	4.027E-18	317	0.213	0.233	1ee9A.pdb.gz	The X-ray structure of the NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase from Saccharomyces cerevisiae.
17	PDB:1a7aA	0.273	0.230	1.493E-6	431	0.153	0.123	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
18	PDB:1npdB	0.469	0.550	2.241E-6	288	0.118	0.142	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
19	PDB:3ce6A	0.275	0.208	2.517E-6	486	0.164	0.117	3ce6A.pdb.gz	Crystal structures of Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase in ternary complex with substrate and inhibitors.
20	PDB:1sc6D	0.209	0.193	1.206E-5	384	0.133	0.120	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZUA0	0.0	605	338	0.862	0.885	MTD2L_RAT Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mthfd2l PE=1 SV=1
2	Q9H903	0.0	703	347	1.000	1.000	MTD2L_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2L PE=1 SV=3
3	P18155	4.99e-169	476	350	0.643	0.637	MTDC_MOUSE Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Mthfd2 PE=1 SV=1
4	P13995	1.31e-164	465	350	0.637	0.631	MTDC_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2
5	B2R7W0	2.04e-164	464	344	0.637	0.642	B2R7W0_HUMAN methenyltetrahydrofolate cyclohydrolase OS=Homo sapiens OX=9606 PE=1 SV=1
6	P54382	1.87e-82	253	283	0.386	0.473	FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) OX=224308 GN=folD PE=1 SV=1
7	P24186	1.27e-74	234	288	0.380	0.458	FOLD_ECOLI Bifunctional protein FolD OS=Escherichia coli (strain K12) OX=83333 GN=folD PE=1 SV=4
8	O65271	2.63e-74	235	360	0.412	0.397	FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLD4 PE=1 SV=1
9	Q9LHH7	2.31e-71	226	299	0.383	0.445	FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana OX=3702 GN=FOLD2 PE=2 SV=1
10	Q57WP0	1.32e-66	213	298	0.375	0.436	Q57WP0_TRYB2 C-1-tetrahydrofolate synthase, cytoplasmic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.970 PE=1 SV=1
11	P09440	9.21e-65	223	975	0.380	0.135	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
12	Q4Q9F9	5.19e-63	204	298	0.372	0.433	Q4Q9F9_LEIMA methenyltetrahydrofolate cyclohydrolase OS=Leishmania major OX=5664 GN=LMJF_26_0320 PE=1 SV=1
13	O96553	2.62e-61	213	968	0.369	0.132	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
14	O43007	2.38e-59	207	972	0.375	0.134	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
15	Q6FND0	6.88e-59	206	946	0.369	0.135	Q6FND0_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00913g PE=3 SV=1
16	Q8WZJ7	2.23e-58	204	937	0.360	0.133	C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC839.16 PE=3 SV=1
17	P9WG81	7.66e-56	185	281	0.337	0.416	FOLD_MYCTU Bifunctional protein FolD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=folD PE=1 SV=1
18	P27653	2.14e-53	191	935	0.329	0.122	C1TC_RAT C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mthfd1 PE=1 SV=3
19	P11586	5.41e-53	189	935	0.340	0.126	C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=4
20	V9GYY3	6.02e-53	189	922	0.340	0.128	V9GYY3_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03435 Sacchrp_dh_NADP	1.2e+02	14.3	Saccharopine dehydrogenase NADP binding domain
2	PF00763 THF_DHG_CYH	2e-33	126.4	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
3	PF02882 THF_DHG_CYH_C	1.2e-58	208.5	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371253	0.993	Trifunctional purine biosynthetic protein adenosine-3
2	9606.ENSP00000318868	0.990	Serine hydroxymethyltransferase, cytosolic
3	9606.ENSP00000333667	0.989	Serine hydroxymethyltransferase, mitochondrial
4	9606.ENSP00000236959	0.983	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000273588	0.979	Aminomethyltransferase, mitochondrial
6	9606.ENSP00000365777	0.968	Methylenetetrahydrofolate reductase
7	9606.ENSP00000315644	0.961	Thymidylate synthase
8	9606.ENSP00000377617	0.961	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
9	9606.ENSP00000455643	0.961	5-formyltetrahydrofolate cyclo-ligase
10	9606.ENSP00000258494	0.960	Mitochondrial 10-formyltetrahydrofolate dehydrogenase
11	9606.ENSP00000258874	0.960	5-formyltetrahydrofolate cyclo-ligase
12	9606.ENSP00000220058	0.953	Methionyl-tRNA formyltransferase, mitochondrial
13	9606.ENSP00000478253	0.946	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
14	9606.ENSP00000273450	0.935	Cytosolic 10-formyltetrahydrofolate dehydrogenase
15	9606.ENSP00000216605	0.934	C-1-tetrahydrofolate synthase, cytoplasmic
16	9606.ENSP00000291670	0.929	Formimidoyltransferase-cyclodeaminase
17	9606.ENSP00000370737	0.784	Glycine dehydrogenase (decarboxylating), mitochondrial
18	9606.ENSP00000360268	0.727	Delta-1-pyrroline-5-carboxylate synthase
19	9606.ENSP00000476535	0.697	annotation not available
20	9606.ENSP00000485525	0.691	Adenylosuccinate lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004486	1.000	methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity
GO:0004477	1.000	methenyltetrahydrofolate cyclohydrolase activity
GO:0005515	0.995	protein binding
GO:0004487	0.993	methylenetetrahydrofolate dehydrogenase (NAD+) activity
GO:0004488	0.869	methylenetetrahydrofolate dehydrogenase (NADP+) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901360	0.998	organic cyclic compound metabolic process
GO:0046483	0.997	heterocycle metabolic process
GO:0006725	0.997	cellular aromatic compound metabolic process
GO:0019752	0.992	carboxylic acid metabolic process
GO:0006760	0.987	folic acid-containing compound metabolic process
GO:0043648	0.975	dicarboxylic acid metabolic process
GO:0006767	0.911	water-soluble vitamin metabolic process
GO:0043603	0.694	amide metabolic process
GO:0044238	0.398	primary metabolic process
GO:0046653	0.377	tetrahydrofolate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0005759	0.968	mitochondrial matrix
GO:0016020	0.761	membrane
GO:0031090	0.395	organelle membrane
GO:0031981	0.336	nuclear lumen
GO:0005829	0.304	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.1.5	1.000	methylenetetrahydrofolate dehydrogenase (NADP(+)).
RHEA:23700	1.000	(6R)-5,10-methenyltetrahydrofolate + H2O = (6R)-10-formyltetrahydrofolate + H(+)
EC:3.5.4.9	1.000	methenyltetrahydrofolate cyclohydrolase.
RHEA:22892	0.993	(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NAD(+) = (6R)-5,10-methenyltetrahydrofolate + NADH
EC:1.5.1.15	0.993	methylenetetrahydrofolate dehydrogenase (NAD(+)).
RHEA:22812	0.869	(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NADP(+) = (6R)-5,10-methenyltetrahydrofolate + NADPH

[back to server]