StarFunc result for job id Q9H936

User Input

>input (323 residues)
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K5L2	0.988	0.988	1.408E-39	323	0.947	0.947	A0A0G2K5L2.pdb.gz	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
2	AFDB:Q505J6	0.911	0.920	1.626E-28	320	0.625	0.631	Q505J6.pdb.gz	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
3	AFDB:Q9H1K4	0.891	0.913	2.017E-28	315	0.644	0.660	Q9H1K4.pdb.gz	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
4	AFDB:Q9VGF7	0.863	0.868	7.350E-28	321	0.576	0.579	Q9VGF7.pdb.gz	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
5	AFDB:Q8INJ3	0.656	0.663	3.187E-20	319	0.514	0.520	Q8INJ3.pdb.gz	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
6	AFDB:Q9QXX4	0.752	0.374	1.161E-19	676	0.396	0.189	Q9QXX4.pdb.gz	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
7	AFDB:Q5AL11	0.777	0.355	1.322E-19	731	0.390	0.172	Q5AL11.pdb.gz	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
8	AFDB:Q9VA73	0.769	0.368	2.871E-19	695	0.375	0.174	Q9VA73.pdb.gz	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
9	AFDB:O75746	0.751	0.372	4.418E-19	678	0.402	0.192	O75746.pdb.gz	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
10	AFDB:Q12482	0.752	0.279	2.586E-18	902	0.356	0.127	Q12482.pdb.gz	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
11	PDB:4c9qB	0.713	0.788	1.934E-11	290	0.211	0.234	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.720	0.787	9.530E-11	293	0.207	0.229	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.519	0.564	4.416E-9	292	0.229	0.253	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.468	0.496	1.106E-4	297	0.220	0.239	2lckA.pdb.gz
15	PDB:4f4cA	0.142	0.056	2.375E-1	1250	0.136	0.035	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
16	PDB:5x3xM	0.165	0.225	3.655E-1	207	0.105	0.164	5x3xM.pdb.gz
17	PDB:7p5cA	0.128	0.115	3.655E-1	392	0.152	0.125	7p5cA.pdb.gz
18	PDB:4yzfA	0.130	0.098	4.734E-1	475	0.133	0.091	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
19	PDB:7c76B	0.154	0.124	5.160E-1	483	0.152	0.101	7c76B.pdb.gz
20	PDB:7ph3A	0.155	0.113	6.683E-1	577	0.130	0.073	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5L2	0.0	607	323	0.947	0.947	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
2	Q9D6M3	0.0	611	323	0.957	0.957	GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus OX=10090 GN=Slc25a22 PE=1 SV=1
3	Q9H936	0.0	652	323	1.000	1.000	GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1
4	Q9DB41	3.21e-147	419	320	0.641	0.647	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
5	Q9H1K4	1.48e-146	417	315	0.644	0.660	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
6	Q505J6	4.99e-144	410	320	0.628	0.634	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
7	Q9VGF7	3.13e-118	345	321	0.542	0.545	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
8	Q8INJ3	4.15e-109	322	319	0.514	0.520	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
9	A8WHE0	9.46e-79	242	240	0.399	0.537	A8WHE0_DROME AT11783p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
10	O75746	1.16e-65	220	678	0.409	0.195	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
11	Q8BH59	6.37e-65	218	677	0.406	0.194	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
12	F1LX07	6.67e-65	218	676	0.402	0.192	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
13	Q9UJS0	2.31e-64	217	675	0.402	0.193	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
14	Q9QXX4	7.70e-64	215	676	0.399	0.191	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
15	Q9VA73	2.59e-61	209	695	0.375	0.174	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
16	Q5AL11	2.79e-54	190	731	0.387	0.171	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
17	Q12482	2.29e-52	186	902	0.356	0.127	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
18	Q7KSQ0	1.50e-33	127	317	0.263	0.268	Q7KSQ0_DROME LD46175p OS=Drosophila melanogaster OX=7227 GN=sea PE=1 SV=1
19	P79110	3.69e-31	120	311	0.263	0.273	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1
20	Q27257	8.80e-29	114	312	0.282	0.292	DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans OX=6239 GN=dif-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14074 DUF4257	4e+02	12.6	Protein of unknown function (DUF4257)
2	PF00153 Mito_carr	7e-60	210.3	Mitochondrial carrier protein
3	PF20560 MotA_N	2.5e+02	13.3	Motility protein A N-terminal
4	PF10193 Telomere_reg-2	2.6e+02	13.4	Telomere length regulation protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377784	0.900	Guanylyl cyclase-activating protein 1
2	9606.ENSP00000360822	0.700	Potassium channel subfamily T member 1
3	9606.ENSP00000329033	0.688	Mitochondrial glutamate carrier 2
4	9606.ENSP00000369325	0.667	Cyclin-dependent kinase-like 5
5	9606.ENSP00000293970	0.660	TBC1 domain family member 24
6	9606.ENSP00000362399	0.652	Syntaxin-binding protein 1
7	9606.ENSP00000323511	0.646	Bifunctional polynucleotide phosphatase/kinase
8	9606.ENSP00000362125	0.644	Protocadherin-19
9	9606.ENSP00000264360	0.642	Protocadherin-10
10	9606.ENSP00000368332	0.627	Homeobox protein ARX
11	9606.ENSP00000338185	0.618	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
12	9606.ENSP00000253401	0.615	Rho guanine nucleotide exchange factor 9
13	9606.ENSP00000346534	0.614	Sodium channel protein type 8 subunit alpha
14	9606.ENSP00000225573	0.611	Pyridoxine-5'-phosphate oxidase
15	9606.ENSP00000303540	0.608	Sodium channel protein type 1 subunit alpha
16	9606.ENSP00000352035	0.599	Potassium voltage-gated channel subfamily KQT member 2
17	9606.ENSP00000361824	0.598	Spectrin alpha chain, non-erythrocytic 1
18	9606.ENSP00000294725	0.594	Potassium channel subfamily T member 2
19	9606.ENSP00000387694	0.578	Solute carrier family 12 member 5
20	9606.ENSP00000364586	0.541	Sodium channel protein type 2 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.999	salt transmembrane transporter activity
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0015179	0.997	L-amino acid transmembrane transporter activity
GO:0005416	0.995	amino acid:monoatomic cation symporter activity
GO:0005313	0.991	L-glutamate transmembrane transporter activity
GO:0005488	0.934	binding
GO:0005515	0.920	protein binding
GO:0015078	0.815	proton transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1905039	0.998	carboxylic acid transmembrane transport
GO:0015807	0.990	L-amino acid transport
GO:0042886	0.987	amide transport
GO:0003333	0.986	amino acid transmembrane transport
GO:1902475	0.983	L-alpha-amino acid transmembrane transport
GO:0015800	0.966	acidic amino acid transport
GO:0006835	0.964	dicarboxylic acid transport
GO:0015813	0.917	L-glutamate transmembrane transport
GO:0065007	0.332	biological regulation
GO:0050789	0.314	regulation of biological process
GO:0006811	0.301	monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031967	0.988	organelle envelope
GO:0031090	0.966	organelle membrane
GO:0019866	0.961	organelle inner membrane
GO:0005740	0.957	mitochondrial envelope
GO:0005743	0.939	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:66336	0.991	L-glutamate(out) = L-glutamate(in)

[back to server]