StarFunc result for job id Q9H944

User Input

>input (212 residues)
MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTG
KLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYC
DFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRH
DAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XIE9	0.999	0.999	2.140E-41	212	0.981	0.981	Q5XIE9.pdb.gz	MED20_RAT Mediator of RNA polymerase II transcription subunit 20 OS=Rattus norvegicus OX=10116 GN=Med20 PE=2 SV=1
2	PDB:7emfT	0.887	0.973	4.368E-32	193	0.906	0.995	7emfT.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:P91641	0.895	0.759	7.744E-23	252	0.406	0.341	P91641.pdb.gz	MED20_DROME Mediator of RNA polymerase II transcription subunit 20 OS=Drosophila melanogaster OX=7227 GN=MED20 PE=1 SV=2
4	AFDB:Q6NPF4	0.781	0.758	2.542E-14	219	0.245	0.237	Q6NPF4.pdb.gz	MD20A_ARATH Mediator of RNA polymerase II transcription subunit 20a OS=Arabidopsis thaliana OX=3702 GN=MED20A PE=1 SV=1
5	AFDB:Q10317	0.630	0.681	7.511E-11	193	0.156	0.171	Q10317.pdb.gz	MED20_SCHPO Mediator of RNA polymerase II transcription subunit 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med20 PE=1 SV=2
6	PDB:5n9jY	0.582	0.653	2.038E-9	185	0.146	0.168	5n9jY.pdb.gz
7	AFDB:A0A1D8PLN4	0.723	0.653	2.383E-9	237	0.132	0.118	A0A1D8PLN4.pdb.gz	A0A1D8PLN4_CANAL Mediator of RNA polymerase II transcription subunit 20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MED20 PE=3 SV=1
8	PDB:4gwpF	0.609	0.617	2.332E-8	209	0.142	0.144	4gwpF.pdb.gz
9	AFDB:P34162	0.680	0.686	2.576E-8	210	0.142	0.143	P34162.pdb.gz	MED20_YEAST Mediator of RNA polymerase II transcription subunit 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRB2 PE=1 SV=1
10	PDB:7enar	0.402	0.411	1.061E-5	206	0.123	0.126	7enar.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
11	AFDB:O69199	0.445	0.481	1.471E-5	191	0.156	0.173	O69199.pdb.gz	CYAB_AERHY Adenylate cyclase CyaB OS=Aeromonas hydrophila OX=644 GN=cyaB PE=1 SV=3
12	AFDB:B0BN39	0.416	0.422	2.744E-5	208	0.113	0.115	B0BN39.pdb.gz	B0BN39_RAT Mediator of RNA polymerase II transcription subunit 18 OS=Rattus norvegicus OX=10116 GN=Med18 PE=2 SV=1
13	AFDB:Q9XZT1	0.446	0.437	3.073E-5	217	0.085	0.083	Q9XZT1.pdb.gz	MED18_DROME Mediator of RNA polymerase II transcription subunit 18 OS=Drosophila melanogaster OX=7227 GN=MED18 PE=1 SV=1
14	AFDB:Q9BU02	0.401	0.377	3.855E-5	230	0.118	0.109	Q9BU02.pdb.gz	THTPA_HUMAN Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA PE=1 SV=3
15	PDB:2hzsD	0.418	0.415	9.679E-5	214	0.104	0.103	2hzsD.pdb.gz	Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
16	PDB:3bhdA	0.416	0.417	1.024E-4	211	0.123	0.123	3bhdA.pdb.gz
17	PDB:2jmuA	0.410	0.395	1.805E-4	224	0.132	0.125	2jmuA.pdb.gz
18	PDB:7nvre	0.443	0.531	3.992E-4	167	0.123	0.156	7nvre.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
19	PDB:4gwpE	0.378	0.329	5.299E-4	253	0.066	0.055	4gwpE.pdb.gz
20	PDB:5a60A	0.331	0.189	7.036E-4	429	0.108	0.054	5a60A.pdb.gz	Structural Determinants for Substrate Binding and Catalysis in Triphosphate Tunnel Metalloenzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H944	1.73e-160	443	212	1.000	1.000	MED20_HUMAN Mediator of RNA polymerase II transcription subunit 20 OS=Homo sapiens OX=9606 GN=MED20 PE=1 SV=1
2	Q5XIE9	2.57e-158	437	212	0.981	0.981	MED20_RAT Mediator of RNA polymerase II transcription subunit 20 OS=Rattus norvegicus OX=10116 GN=Med20 PE=2 SV=1
3	Q9R0X0	3.17e-157	435	212	0.972	0.972	MED20_MOUSE Mediator of RNA polymerase II transcription subunit 20 OS=Mus musculus OX=10090 GN=Med20 PE=1 SV=1
4	P91641	2.23e-51	168	252	0.401	0.337	MED20_DROME Mediator of RNA polymerase II transcription subunit 20 OS=Drosophila melanogaster OX=7227 GN=MED20 PE=1 SV=2
5	Q6NPF4	0.002	40.4	219	0.132	0.128	MD20A_ARATH Mediator of RNA polymerase II transcription subunit 20a OS=Arabidopsis thaliana OX=3702 GN=MED20A PE=1 SV=1
6	Q9C667	0.75	33.1	611	0.061	0.021	CPNB4_ARATH Chaperonin 60 subunit beta 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN60B4 PE=1 SV=1
7	Q4X1P0	1.9	32.0	587	0.071	0.026	Q4X1P0_ASPFU Antigenic mitochondrial protein HSP60, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G09290 PE=3 SV=1
8	C9JL19	2.9	29.3	83	0.066	0.169	C9JL19_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=1
9	C9JCQ4	3.2	29.6	94	0.066	0.149	C9JCQ4_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=1
10	Q5B041	4.4	30.8	588	0.066	0.024	HSP60_EMENI Heat shock protein 60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hsp60 PE=1 SV=1
11	P23767	4.5	30.4	359	0.085	0.050	GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis OX=8355 GN=gata1-a PE=2 SV=1
12	Q90410	5.9	30.0	418	0.080	0.041	Q90410_DANRE GATA binding protein 1a OS=Danio rerio OX=7955 GN=zg1 PE=2 SV=1
13	Q9VMN5	6.4	30.0	576	0.066	0.024	CH60C_DROME 60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hsp60C PE=2 SV=2
14	O02649	6.7	30.0	573	0.066	0.024	CH60A_DROME Heat shock protein 60A OS=Drosophila melanogaster OX=7227 GN=Hsp60A PE=1 SV=3
15	C9JL25	8.0	29.3	175	0.066	0.080	C9JL25_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=1
16	Q91428	8.2	29.6	438	0.085	0.041	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
17	P23825	8.3	29.6	444	0.085	0.041	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1
18	P23824	8.4	29.6	466	0.085	0.039	GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1
19	Q86VW0	9.0	29.6	696	0.075	0.023	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
20	E7EXB4	9.4	29.3	221	0.066	0.063	E7EXB4_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08612 Med20	2.3e-45	166.3	TATA-binding related factor (TRF) of subunit 20 of Mediator complex

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005880

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011923	0.992	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
2	61853.ENSNLEP00000023696	0.991	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	61853.ENSNLEP00000002236	0.988	Mediator complex subunit 6
4	61853.ENSNLEP00000013783	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	61853.ENSNLEP00000016487	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
6	61853.ENSNLEP00000017539	0.987	Mediator complex subunit 29
7	61853.ENSNLEP00000015585	0.984	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	61853.ENSNLEP00000017049	0.978	Cyclin-dependent kinase 8
9	61853.ENSNLEP00000020163	0.977	Mediator complex subunit 28
10	61853.ENSNLEP00000005897	0.976	Mediator complex subunit 30
11	61853.ENSNLEP00000015868	0.975	Mediator complex subunit 22
12	61853.ENSNLEP00000001446	0.972	Mediator complex subunit 24
13	61853.ENSNLEP00000002188	0.971	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
14	61853.ENSNLEP00000009639	0.971	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	61853.ENSNLEP00000006572	0.970	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
16	61853.ENSNLEP00000000991	0.969	Mediator of RNA polymerase II transcription subunit 1
17	61853.ENSNLEP00000015556	0.967	Cyclin-dependent kinase 19
18	61853.ENSNLEP00000016790	0.967	Cyclin C
19	61853.ENSNLEP00000003648	0.959	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
20	61853.ENSNLEP00000004752	0.959	Mediator of RNA polymerase II transcription subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.438	catalytic activity
GO:0061630	0.372	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0043170	0.961	macromolecule metabolic process
GO:0044237	0.953	cellular metabolic process
GO:0050794	0.951	regulation of cellular process
GO:0019222	0.949	regulation of metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0080090	0.926	regulation of primary metabolic process
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0051252	0.921	regulation of RNA metabolic process
GO:0010556	0.916	regulation of macromolecule biosynthetic process
GO:0031326	0.916	regulation of cellular biosynthetic process
GO:0006357	0.909	regulation of transcription by RNA polymerase II
GO:0032502	0.803	developmental process
GO:0034641	0.772	cellular nitrogen compound metabolic process
GO:0006725	0.764	cellular aromatic compound metabolic process
GO:1901360	0.747	organic cyclic compound metabolic process
GO:0009058	0.739	biosynthetic process
GO:0048856	0.738	anatomical structure development
GO:0010467	0.735	gene expression
GO:0016070	0.731	RNA metabolic process
GO:0044249	0.721	cellular biosynthetic process
GO:0006366	0.649	transcription by RNA polymerase II
GO:0060537	0.644	muscle tissue development
GO:0061061	0.643	muscle structure development
GO:0048518	0.623	positive regulation of biological process
GO:0060538	0.610	skeletal muscle organ development
GO:0043412	0.608	macromolecule modification
GO:0009893	0.567	positive regulation of metabolic process
GO:0007519	0.560	skeletal muscle tissue development
GO:0048522	0.559	positive regulation of cellular process
GO:0010604	0.496	positive regulation of macromolecule metabolic process
GO:1901564	0.493	organonitrogen compound metabolic process
GO:0030154	0.489	cell differentiation
GO:0035914	0.474	skeletal muscle cell differentiation
GO:0051173	0.395	positive regulation of nitrogen compound metabolic process
GO:0031325	0.395	positive regulation of cellular metabolic process
GO:0019538	0.390	protein metabolic process
GO:0009891	0.389	positive regulation of biosynthetic process
GO:0045935	0.389	positive regulation of nucleobase-containing compound metabolic process
GO:0036211	0.378	protein modification process
GO:0010557	0.350	positive regulation of macromolecule biosynthetic process
GO:0031328	0.350	positive regulation of cellular biosynthetic process
GO:0051254	0.349	positive regulation of RNA metabolic process
GO:0045944	0.315	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0140513	0.974	nuclear protein-containing complex
GO:0070847	0.961	core mediator complex
GO:0016592	0.935	mediator complex
GO:1990234	0.503	transferase complex
GO:0140535	0.498	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.374	Transferases.

[back to server]