StarFunc result for job id Q9H977

User Input

>input (334 residues)
MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPEGVPLAQRQLH
AKEGAGVSPPLITQVHWCVLPFRVLLVLTSHRGIQMYESNGYTMVYWHALDSGDASPVQA
VFARGIAASGHFICVGTWSGRVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPAQGQDC
VADMVTADDSGLLCVWRSGPEFTLLTRIPGFGVPCPSVQLWQGIIAAGYGNGQVHLYEAT
TGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECV
ADTQLCGARFCDSSGNSFAVTGYDLAEIRRFSSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H977	1.000	1.000	5.257E-63	334	1.000	1.000	Q9H977.pdb.gz	WDR54_HUMAN WD repeat-containing protein 54 OS=Homo sapiens OX=9606 GN=WDR54 PE=1 SV=1
2	AFDB:O74855	0.644	0.449	1.218E-12	502	0.165	0.110	O74855.pdb.gz	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
3	AFDB:Q8MSW9	0.731	0.523	1.475E-12	484	0.174	0.120	Q8MSW9.pdb.gz	Q8MSW9_DROME LD17611p OS=Drosophila melanogaster OX=7227 GN=U3-55K PE=1 SV=1
4	AFDB:Q9VPR4	0.631	0.453	2.268E-12	488	0.159	0.109	Q9VPR4.pdb.gz	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
5	PDB:7qdrC	0.726	0.787	4.411E-12	305	0.162	0.177	7qdrC.pdb.gz
6	PDB:5lcwR	0.722	0.636	5.092E-12	383	0.153	0.133	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
7	AFDB:P25382	0.657	0.448	8.259E-12	515	0.165	0.107	P25382.pdb.gz	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3
8	AFDB:Q9ERF3	0.728	0.793	8.664E-12	305	0.153	0.167	Q9ERF3.pdb.gz	SKI8_MOUSE Superkiller complex protein 8 OS=Mus musculus OX=10090 GN=Skic8 PE=1 SV=1
9	AFDB:Q6DTM3	0.696	0.250	1.049E-11	1047	0.147	0.047	Q6DTM3.pdb.gz	AHI1_RAT Jouberin OS=Rattus norvegicus OX=10116 GN=Ahi1 PE=1 SV=1
10	PDB:7bt6x	0.679	0.488	1.326E-11	488	0.171	0.117	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
11	AFDB:Q9Y3F4	0.677	0.649	1.467E-11	350	0.132	0.126	Q9Y3F4.pdb.gz	STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1
12	PDB:7mq8LR	0.627	0.293	1.531E-11	773	0.153	0.066	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q4Q7Y7	0.701	0.746	1.539E-11	312	0.153	0.163	Q4Q7Y7.pdb.gz	Q4Q7Y7_LEIMA Small ribosomal subunit protein RACK1 OS=Leishmania major OX=5664 GN=LACK2 PE=2 SV=1
14	AFDB:Q9H2Y7	0.637	0.132	1.539E-11	1883	0.150	0.027	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
15	PDB:5jcsq	0.593	0.426	2.245E-11	488	0.147	0.100	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
16	PDB:5nnzA	0.605	0.603	2.355E-11	335	0.153	0.152	5nnzA.pdb.gz
17	PDB:5wyjBE	0.667	0.319	2.471E-11	753	0.150	0.066	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
18	PDB:4ui9R	0.696	0.611	5.066E-11	387	0.159	0.137	4ui9R.pdb.gz	Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
19	PDB:7wb4c	0.636	0.617	5.314E-11	346	0.150	0.145	7wb4c.pdb.gz
20	PDB:6bk8D	0.664	0.623	6.436E-11	359	0.123	0.114	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H977	0.0	687	334	1.000	1.000	WDR54_HUMAN WD repeat-containing protein 54 OS=Homo sapiens OX=9606 GN=WDR54 PE=1 SV=1
2	O74184	8.81e-06	49.3	314	0.138	0.146	WAT1_SCHPO Target of rapamycin complex subunit wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop3 PE=1 SV=1
3	Q5U4D9	1.02e-04	45.8	341	0.144	0.141	THOC6_MOUSE THO complex subunit 6 homolog OS=Mus musculus OX=10090 GN=Thoc6 PE=1 SV=1
4	Q86W42	3.41e-04	44.3	341	0.135	0.132	THOC6_HUMAN THO complex subunit 6 homolog OS=Homo sapiens OX=9606 GN=THOC6 PE=1 SV=1
5	A8ILK1	0.002	42.4	615	0.057	0.031	CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1
6	O42948	0.002	42.4	1026	0.084	0.027	YBPD_SCHPO Uncharacterized WD repeat-containing protein C16H5.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16H5.13 PE=4 SV=1
7	Q389W0	0.005	40.8	444	0.057	0.043	Q389W0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0110 PE=3 SV=1
8	Q9UTN4	0.005	40.8	509	0.114	0.075	PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfs2 PE=4 SV=1
9	A8J1V4	0.012	40.0	1764	0.093	0.018	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
10	Q9LVF2	0.016	39.7	955	0.081	0.028	Q9LVF2_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At3g21540 PE=1 SV=1
11	A0A1L8HX76	0.018	38.9	428	0.057	0.044	WDR18_XENLA WD repeat-containing protein 18 OS=Xenopus laevis OX=8355 GN=wdr18 PE=3 SV=1
12	A0A0A0MQU0	0.019	38.9	429	0.048	0.037	A0A0A0MQU0_HUMAN WD repeat-containing protein 18 (Fragment) OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=1
13	Q9BV38	0.020	38.9	432	0.048	0.037	WDR18_HUMAN WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2
14	Q4V8C4	0.022	38.5	328	0.096	0.098	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
15	Q9FLX9	0.027	38.5	473	0.117	0.082	NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana OX=3702 GN=NLE1 PE=2 SV=1
16	A0A0A1CTQ1	0.030	38.5	506	0.150	0.099	A0A0A1CTQ1_SCHMD Wdr-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=wdr-1 PE=2 SV=1
17	Q9FNN2	0.035	38.5	589	0.066	0.037	WDR26_ARATH WD repeat-containing protein 26 homolog OS=Arabidopsis thaliana OX=3702 GN=WDR26 PE=1 SV=1
18	Q9V9V0	0.035	38.1	424	0.111	0.087	Q9V9V0_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=CstF50 PE=1 SV=1
19	Q68EI0	0.051	37.7	431	0.057	0.044	WDR18_DANRE WD repeat-containing protein 18 OS=Danio rerio OX=7955 GN=wdr18 PE=2 SV=1
20	Q8BH57	0.059	37.7	676	0.066	0.033	WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus OX=10090 GN=Wdr48 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	21	16.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF13570 PQQ_3	9e+02	11.8	PQQ-like domain
3	PF00400 WD40	2.6e+02	13.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000006526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000235532	0.678	Protein OSCP1
2	9606.ENSP00000328079	0.660	WD repeat-containing protein 53
3	9606.ENSP00000371051	0.639	Zinc finger ZZ-type and EF-hand domain containing 1
4	9606.ENSP00000484687	0.633	Zinc finger HIT-type containing 3
5	9606.ENSP00000480322	0.627	CD99 antigen-like protein 2
6	9606.ENSP00000263672	0.622	Signal peptidase complex subunit 2
7	9606.ENSP00000377428	0.620	Cilia and flagella associated protein 44
8	9606.ENSP00000311977	0.615	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like
9	9606.ENSP00000326200	0.606	Zinc finger and BTB domain-containing protein 11
10	9606.ENSP00000295226	0.603	Coiled-coil domain containing 140
11	9606.ENSP00000351100	0.590	WD repeat-containing protein 55
12	9606.ENSP00000437464	0.545	F-box/LRR-repeat protein 17
13	9606.ENSP00000253812	0.517	Protocadherin gamma-A3
14	9606.ENSP00000318690	0.507	GC-rich sequence DNA-binding factor 2
15	9606.ENSP00000408236	0.503	Cytohesin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042803	0.991	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0048519	0.953	negative regulation of biological process
GO:0009966	0.922	regulation of signal transduction
GO:0048523	0.894	negative regulation of cellular process
GO:0030100	0.865	regulation of endocytosis
GO:0051129	0.859	negative regulation of cellular component organization
GO:0048259	0.796	regulation of receptor-mediated endocytosis
GO:0009987	0.792	cellular process
GO:0002090	0.699	regulation of receptor internalization
GO:0045806	0.699	negative regulation of endocytosis
GO:1901184	0.697	regulation of ERBB signaling pathway
GO:0043408	0.694	regulation of MAPK cascade
GO:0048261	0.661	negative regulation of receptor-mediated endocytosis
GO:0042058	0.601	regulation of epidermal growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005622	0.939	intracellular anatomical structure
GO:0005737	0.922	cytoplasm
GO:0043229	0.916	intracellular organelle
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0005634	0.760	nucleus
GO:0031982	0.681	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]