StarFunc result for job id Q9H981

User Input

>input (624 residues)
MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIVIHPGSTTLRI
GRATDTLPASIPHVIARRHKQQGQPLYKDSWLLREGLNKPESNEQRQNGLKMVDQAIWSK
KMSNGTRRIPVSPEQARSYNKQMRPAILDHCSGNKWTNTSHHPEYLVGEEALYVNPLDCY
NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY
NKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSH
RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL
QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPH
DEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDG
LMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG
GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE
LWIYQREWQRFGVRMLRERAAFVW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2S9	0.937	0.937	0.000	624	0.971	0.971	Q8R2S9.pdb.gz	ARP8_MOUSE Actin-related protein 8 OS=Mus musculus OX=10090 GN=Actr8 PE=2 SV=1
2	PDB:4fo0A	0.801	0.995	3.279E-94	502	0.801	0.996	4fo0A.pdb.gz	Structure of Actin-related protein 8 and its contribution to nucleosome binding.
3	AFDB:Q9VX09	0.758	0.778	9.996E-55	607	0.316	0.325	Q9VX09.pdb.gz	ARP8_DROME Actin-related protein 8 OS=Drosophila melanogaster OX=7227 GN=Arp8 PE=1 SV=1
4	AFDB:Q9US07	0.697	0.659	2.362E-43	662	0.271	0.255	Q9US07.pdb.gz	ARP8_SCHPO Probable actin-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC664.02c PE=1 SV=2
5	AFDB:Q12386	0.684	0.495	2.819E-39	881	0.253	0.179	Q12386.pdb.gz	ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP8 PE=1 SV=1
6	AFDB:P12432	0.530	0.862	1.786E-24	376	0.147	0.245	P12432.pdb.gz	ACT1_TRYBB Actin A OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
7	AFDB:Q9U1E8	0.530	0.862	2.886E-24	376	0.141	0.234	Q9U1E8.pdb.gz	Q9U1E8_LEIMA Actin OS=Leishmania major OX=5664 GN=ACT PE=3 SV=1
8	AFDB:A0A1D8PFR4	0.521	0.848	8.387E-24	376	0.155	0.258	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
9	AFDB:P07829	0.520	0.844	8.847E-24	376	0.136	0.226	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
10	AFDB:P10989	0.518	0.843	9.332E-24	375	0.155	0.259	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
11	AFDB:B6VNT8	0.520	0.842	1.038E-23	377	0.135	0.223	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
12	PDB:1c0gA	0.523	0.869	8.069E-23	368	0.131	0.223	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
13	PDB:6tu4A	0.521	0.849	1.054E-22	372	0.138	0.231	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:1yagA	0.523	0.860	2.473E-22	372	0.151	0.253	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
15	PDB:4cbxA	0.497	0.847	4.447E-22	358	0.135	0.235	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
16	PDB:4pl7A	0.486	0.780	3.345E-20	382	0.139	0.228	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
17	PDB:3qb0B	0.516	0.734	1.386E-17	430	0.135	0.195	3qb0B.pdb.gz	Structural biochemistry of nuclear actin-related proteins 4 and 8 reveals their interaction with actin.
18	PDB:6w18B	0.489	0.808	5.852E-17	367	0.146	0.248	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
19	PDB:5i9eC	0.513	0.776	2.606E-16	404	0.120	0.186	5i9eC.pdb.gz	Crystal structure of a nuclear actin ternary complex.
20	PDB:4a7fA	0.486	0.782	6.117E-16	375	0.144	0.240	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y849	0.0	753	378	0.599	0.989	H0Y849_HUMAN Actin-related protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=ACTR8 PE=1 SV=1
2	Q8R2S9	0.0	1279	624	0.971	0.971	ARP8_MOUSE Actin-related protein 8 OS=Mus musculus OX=10090 GN=Actr8 PE=2 SV=1
3	Q9H981	0.0	1305	624	1.000	1.000	ARP8_HUMAN Actin-related protein 8 OS=Homo sapiens OX=9606 GN=ACTR8 PE=1 SV=2
4	Q9VX09	2.23e-96	309	607	0.322	0.331	ARP8_DROME Actin-related protein 8 OS=Drosophila melanogaster OX=7227 GN=Arp8 PE=1 SV=1
5	Q9US07	4.52e-73	249	662	0.276	0.260	ARP8_SCHPO Probable actin-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC664.02c PE=1 SV=2
6	Q12386	1.50e-47	181	881	0.171	0.121	ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP8 PE=1 SV=1
7	Q8TDG2	1.16e-12	72.4	376	0.109	0.181	ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens OX=9606 GN=ACTRT1 PE=2 SV=2
8	Q9LSD6	1.30e-12	72.0	389	0.095	0.152	ARP2_ARATH Actin-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ARP2 PE=1 SV=1
9	P32381	5.55e-12	70.1	391	0.085	0.136	ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP2 PE=1 SV=1
10	A0A1D8PTX1	7.49e-11	66.6	391	0.090	0.143	A0A1D8PTX1_CANAL Actin-related protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARP2 PE=3 SV=1
11	Q7ZTP2	8.49e-10	63.5	394	0.091	0.145	ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis OX=8355 GN=actr2-a PE=1 SV=1
12	A7MB62	1.63e-09	62.4	394	0.083	0.132	ARP2_BOVIN Actin-related protein 2 OS=Bos taurus OX=9913 GN=ACTR2 PE=1 SV=1
13	B5APU3	1.63e-09	62.4	394	0.083	0.132	B5APU3_PIG Actin-related protein 2 isoform b OS=Sus scrofa OX=9823 PE=2 SV=1
14	P61160	1.63e-09	62.4	394	0.083	0.132	ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1
15	P61161	1.63e-09	62.4	394	0.083	0.132	ARP2_MOUSE Actin-related protein 2 OS=Mus musculus OX=10090 GN=Actr2 PE=1 SV=1
16	Q5M7U6	1.68e-09	62.4	394	0.083	0.132	ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus OX=10116 GN=Actr2 PE=2 SV=1
17	P45891	1.70e-09	62.4	376	0.064	0.106	ACTY_DROME Actin-like protein 53D OS=Drosophila melanogaster OX=7227 GN=Arp53D PE=1 SV=2
18	Q56A35	4.21e-09	61.2	394	0.087	0.137	ARP2B_DANRE Actin-related protein 2-B OS=Danio rerio OX=7955 GN=actr2b PE=2 SV=1
19	P53489	4.23e-09	61.2	395	0.082	0.129	ARP2_CAEEL Actin-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=arx-2 PE=1 SV=1
20	O96019	5.58e-09	60.8	429	0.051	0.075	ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	2e-32	124.0	Actin
2	PF17003 Actin_micro	1.2e-10	52.8	Putative actin-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243903	0.999	Actin-related protein 5
2	9606.ENSP00000355205	0.999	DNA helicase INO80
3	9606.ENSP00000473172	0.997	RuvB-like 2
4	9606.ENSP00000233331	0.995	INO80 complex subunit B
5	9606.ENSP00000318297	0.994	RuvB-like 1
6	9606.ENSP00000391457	0.994	Chromosome 18 open reading frame 37, isoform CRA_a
7	9606.ENSP00000397552	0.990	Actin-like protein 6A
8	9606.ENSP00000262238	0.986	Transcriptional repressor protein YY1
9	9606.ENSP00000356425	0.983	Ubiquitin carboxyl-terminal hydrolase isozyme L5
10	9606.ENSP00000457016	0.983	INO80 complex subunit E
11	9606.ENSP00000467041	0.983	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair
12	9606.ENSP00000436926	0.966	Nuclear factor related to kappa-B-binding protein
13	9606.ENSP00000374213	0.965	E1A-binding protein p400
14	9606.ENSP00000375639	0.950	TCF3 fusion partner
15	9606.ENSP00000349640	0.947	Microspherule protein 1
16	9606.ENSP00000340330	0.941	Histone acetyltransferase KAT5
17	9606.ENSP00000188312	0.924	ARP6 actin related protein 6 homolog
18	9606.ENSP00000349960	0.921	Actin, cytoplasmic 1
19	9606.ENSP00000254900	0.915	Bromodomain-containing protein 8
20	9606.ENSP00000320566	0.915	Inhibitor of growth protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.677	heterocyclic compound binding
GO:0097159	0.677	organic cyclic compound binding
GO:0003824	0.362	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051052	0.993	regulation of DNA metabolic process
GO:0033044	0.992	regulation of chromosome organization
GO:0045935	0.992	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.991	positive regulation of macromolecule metabolic process
GO:0071840	0.988	cellular component organization or biogenesis
GO:0016043	0.984	cellular component organization
GO:0071704	0.913	organic substance metabolic process
GO:0010556	0.899	regulation of macromolecule biosynthetic process
GO:0051252	0.899	regulation of RNA metabolic process
GO:0031326	0.898	regulation of cellular biosynthetic process
GO:0044238	0.880	primary metabolic process
GO:0006807	0.872	nitrogen compound metabolic process
GO:0006325	0.799	chromatin organization
GO:0043170	0.793	macromolecule metabolic process
GO:0010468	0.772	regulation of gene expression
GO:0006355	0.748	regulation of DNA-templated transcription
GO:0031328	0.736	positive regulation of cellular biosynthetic process
GO:0044237	0.726	cellular metabolic process
GO:0006338	0.726	chromatin remodeling
GO:0051254	0.684	positive regulation of RNA metabolic process
GO:0010557	0.679	positive regulation of macromolecule biosynthetic process
GO:0051726	0.598	regulation of cell cycle
GO:1902680	0.572	positive regulation of RNA biosynthetic process
GO:1903508	0.528	positive regulation of nucleic acid-templated transcription
GO:0045893	0.470	positive regulation of DNA-templated transcription
GO:2001020	0.434	regulation of response to DNA damage stimulus
GO:0034641	0.422	cellular nitrogen compound metabolic process
GO:1901360	0.419	organic cyclic compound metabolic process
GO:0006725	0.415	cellular aromatic compound metabolic process
GO:0006139	0.412	nucleobase-containing compound metabolic process
GO:0006996	0.389	organelle organization
GO:2001022	0.382	positive regulation of response to DNA damage stimulus
GO:0051054	0.370	positive regulation of DNA metabolic process
GO:0050896	0.314	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:1904949	0.988	ATPase complex
GO:0000785	0.987	chromatin
GO:0000228	0.982	nuclear chromosome
GO:0097346	0.979	INO80-type complex
GO:0005856	0.973	cytoskeleton
GO:0031011	0.939	Ino80 complex
GO:0005829	0.903	cytosol
GO:0015630	0.746	microtubule cytoskeleton
GO:0005815	0.633	microtubule organizing center
GO:0005813	0.601	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]