StarFunc result for job id Q9H987

User Input

>input (977 residues)
MGAEEEVLVTLSGGAPWGFRLHGGAEQRKPLQVSKIRRRSQAGRAGLRERDQLLAINGVS
CTNLSHASAMSLIDASGNQLVLTVQRLADEGPVQSPSPHELQVLSPLSPLSPEPPGAPVP
QPLQPGSLRSPPDSEAYYGETDSDADGPATQEKPRRPRRRGPTRPTPPGAPPDEVYLSDS
PAEPAPTIPGPPSQGDSRVSSPSWEDGAALQPPPAEALLLPHGPLRPGPHLIPMVGPVPH
PVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTAAPNPHSKGVLMFKK
RRQRAKKYTLVSFGAAAGTGAEEEDGVPPTSESELDEEAFSDARSLTNQSDWDSPYLDME
LARAGSRASEGQGSGLGGQLSEVSGRGVQLFEQQRQRADSSTQELARVEPAAMLNGEGLQ
SPPRAQSAPPEAAVLPPSPLPAPVASPRPFQPGGGAPTPAPSIFNRSARPFTPGLQGQRP
TTTSVIFRPLAPKRANDSLGGLSPAPPPFLSSQGPTPLPSFTSGVPSHAPVSGSPSTPRS
SGPVTATSSLYIPAPSRPVTPGGAPEPPAPPSAAAMTSTASIFLSAPLRPSARPEAPAPG
PGAPEPPSAREQRISVPAARTGILQEARRRGTRKQMFRPGKEETKNSPNPELLSLVQNLD
EKPRAGGAESGPEEDALSLGAEACNFMQPVGARSYKTLPHVTPKTPPPMAPKTPPPMTPK
TPPPVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGP
GLGPRPRSPSPTPSLPPSWKYSPNIRAPPPIAYNPLLSPFFPQAARTLPKAQSQGPRATP
KQGIKALDFMRHQPYQLKTAMFCFDEVPPTPGPIASGSPKTARVQEIRRFSTPAPQPTAE
PLAPTVLAPRAATTLDEPIWRTELASAPVPSPAPPPEAPRGLGASPSSCGFQVARPRFSA
TRTGLQAHVWRPGAGHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BWB1	0.268	0.268	0.000	975	0.876	0.878	Q8BWB1.pdb.gz	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
2	AFDB:Q9H987	0.999	0.999	0.000	977	1.000	1.000	Q9H987.pdb.gz	SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3
3	AFDB:U3JAM7	0.138	0.119	5.872E-49	1184	0.480	0.396	U3JAM7.pdb.gz	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
4	AFDB:F1RCC9	0.140	0.122	3.545E-45	1179	0.436	0.361	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
5	AFDB:Q9UMS6	0.105	0.096	8.046E-37	1093	0.362	0.324	Q9UMS6.pdb.gz	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
6	AFDB:D4A702	0.109	0.093	3.026E-36	1262	0.348	0.269	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
7	AFDB:A7UMX5	0.082	0.081	2.350E-24	996	0.285	0.279	A7UMX5.pdb.gz	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
8	AFDB:A0A096MJ01	0.084	0.113	3.540E-11	726	0.129	0.174	A0A096MJ01.pdb.gz	A0A096MJ01_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
9	AFDB:Q9ULL8	0.092	0.063	1.609E-10	1493	0.175	0.115	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
10	AFDB:A2ALU4	0.096	0.064	1.290E-9	1481	0.191	0.126	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
11	PDB:6t36A	0.085	0.845	5.877E-8	93	0.030	0.312	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
12	PDB:7p70A	0.087	0.203	5.020E-7	407	0.023	0.054	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7pc3A	0.084	0.200	1.773E-6	405	0.025	0.059	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7p73A	0.085	0.194	2.936E-6	420	0.029	0.067	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:7pcbA	0.082	0.190	3.548E-6	415	0.024	0.055	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqnC	0.077	0.175	3.779E-6	414	0.030	0.070	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7pe9I	0.079	0.237	9.139E-6	317	0.020	0.063	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
18	PDB:7qqmA	0.090	0.207	1.334E-5	413	0.024	0.056	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:2xkxA	0.085	0.115	3.030E-5	721	0.026	0.035	2xkxA.pdb.gz
20	PDB:5n7dA	0.084	0.191	3.227E-5	423	0.017	0.040	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BWB1	0.0	1489	975	0.873	0.875	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
2	Q9H987	0.0	1895	977	1.000	1.000	SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3
3	F1RCC9	3.79e-97	334	1179	0.219	0.182	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
4	A0A140LH61	4.61e-97	333	1151	0.217	0.184	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
5	A0A2R8RTS6	2.29e-73	262	879	0.184	0.205	A0A2R8RTS6_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
6	U3JAM7	5.14e-72	262	1184	0.184	0.152	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
7	B4DLE4	2.35e-52	198	698	0.173	0.242	B4DLE4_HUMAN cDNA FLJ54419, highly similar to Synaptopodin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
8	A7UMX5	3.20e-27	122	996	0.104	0.102	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
9	Q8CC35	1.56e-23	109	929	0.129	0.136	SYNPO_MOUSE Synaptopodin OS=Mus musculus OX=10090 GN=Synpo PE=1 SV=2
10	Q9Z327	2.75e-23	108	931	0.098	0.103	SYNPO_RAT Synaptopodin OS=Rattus norvegicus OX=10116 GN=Synpo PE=1 SV=2
11	Q8N3V7	3.42e-21	102	929	0.096	0.101	SYNPO_HUMAN Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2
12	Q91YE8	1.10e-20	100	1087	0.113	0.101	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
13	D4A702	2.97e-20	99.8	1262	0.072	0.055	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
14	H0Y9Y3	4.27e-20	99.0	1155	0.108	0.092	H0Y9Y3_HUMAN Synaptopodin 2 (Fragment) OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=1
15	Q9UMS6	7.07e-20	98.2	1093	0.107	0.096	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
16	R4GKC8	1.57e-11	70.1	419	0.036	0.084	R4GKC8_CHICK PDZ and LIM domain 7 OS=Gallus gallus OX=9031 GN=PDLIM7 PE=1 SV=3
17	A1ZA47	4.17e-11	70.1	2194	0.033	0.015	ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster OX=7227 GN=Zasp52 PE=1 SV=2
18	O75112	4.38e-11	69.3	727	0.034	0.045	LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens OX=9606 GN=LDB3 PE=1 SV=2
19	A0A096MJ01	5.44e-11	68.9	771	0.035	0.044	A0A096MJ01_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
20	A0A8I5Y5H4	5.82e-11	68.9	709	0.035	0.048	A0A8I5Y5H4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05556 Calsarcin	1.9	19.6	Calcineurin-binding protein (Calsarcin)
2	PF00595 PDZ	2.4e-08	45.6	PDZ domain
3	PF13180 PDZ_2	4.3e+02	12.7	PDZ domain
4	PF17820 PDZ_6	0.00015	32.9	PDZ domain
5	PF02163 Peptidase_M50	32	15.2	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352272	0.761	Myozenin-1
2	9606.ENSP00000261448	0.743	Calsequestrin-2
3	9606.ENSP00000262113	0.732	Myomesin-2
4	9606.ENSP00000467141	0.722	Titin
5	9606.ENSP00000394770	0.721	Cardiomyopathy-associated protein 5
6	9606.ENSP00000414670	0.680	Leiomodin-3
7	9606.ENSP00000411932	0.678	Leiomodin-2
8	9606.ENSP00000350719	0.673	Nesprin-2
9	9606.ENSP00000401437	0.670	LIM domain-binding protein 3
10	9606.ENSP00000364464	0.664	Aminopeptidase O
11	9606.ENSP00000341940	0.654	Caveolin-3
12	9606.ENSP00000439281	0.651	Triadin
13	9606.ENSP00000368808	0.650	Small muscular protein
14	9606.ENSP00000303394	0.638	Heat shock protein beta-3
15	9606.ENSP00000422007	0.637	Alpha-actinin-3
16	9606.ENSP00000244669	0.634	C->U-editing enzyme APOBEC-2
17	9606.ENSP00000426290	0.632	Muscular LMNA-interacting protein
18	9606.ENSP00000443495	0.628	Alpha-actinin-2
19	9606.ENSP00000338191	0.620	Beta-2-syntrophin
20	9606.ENSP00000351206	0.620	Beta-taxilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.429	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.967	positive regulation of biological process
GO:0097435	0.964	supramolecular fiber organization
GO:0048522	0.964	positive regulation of cellular process
GO:0030029	0.950	actin filament-based process
GO:0032502	0.947	developmental process
GO:0048856	0.943	anatomical structure development
GO:0032970	0.938	regulation of actin filament-based process
GO:0030036	0.937	actin cytoskeleton organization
GO:1902903	0.935	regulation of supramolecular fiber organization
GO:0032501	0.933	multicellular organismal process
GO:0010646	0.929	regulation of cell communication
GO:0044087	0.914	regulation of cellular component biogenesis
GO:0051493	0.896	regulation of cytoskeleton organization
GO:0022607	0.866	cellular component assembly
GO:0061061	0.863	muscle structure development
GO:0032956	0.838	regulation of actin cytoskeleton organization
GO:0023051	0.827	regulation of signaling
GO:0110053	0.817	regulation of actin filament organization
GO:0048583	0.801	regulation of response to stimulus
GO:1902905	0.800	positive regulation of supramolecular fiber organization
GO:0051495	0.750	positive regulation of cytoskeleton organization
GO:0032231	0.747	regulation of actin filament bundle assembly
GO:0044089	0.675	positive regulation of cellular component biogenesis
GO:0009653	0.648	anatomical structure morphogenesis
GO:0110020	0.644	regulation of actomyosin structure organization
GO:0009966	0.611	regulation of signal transduction
GO:0032233	0.596	positive regulation of actin filament bundle assembly
GO:1902531	0.555	regulation of intracellular signal transduction
GO:0007507	0.481	heart development
GO:0031032	0.459	actomyosin structure organization
GO:0051056	0.439	regulation of small GTPase mediated signal transduction
GO:0030154	0.412	cell differentiation
GO:0042692	0.396	muscle cell differentiation
GO:0048646	0.363	anatomical structure formation involved in morphogenesis
GO:0030239	0.346	myofibril assembly
GO:0051492	0.314	regulation of stress fiber assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005829	0.994	cytosol
GO:0005654	0.993	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0099080	0.935	supramolecular complex
GO:0099512	0.910	supramolecular fiber
GO:0030016	0.802	myofibril
GO:0030017	0.742	sarcomere
GO:0030054	0.741	cell junction
GO:0016604	0.627	nuclear body
GO:0031674	0.505	I band
GO:0016607	0.414	nuclear speck
GO:0030018	0.369	Z disc

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]