StarFunc result for job id Q9H992

User Input

>input (704 residues)
MESKPSRIPRRISVQPSSSLSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASAS
PFQSAWYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWR
HSQVPRSSSMVLGSFGTDLMRERRDLERRTDSSISNLMDYSHRSGDFTTSSYVQDRVPSY
SQGARPKENSMSTLQLNTSSTNHQLPSEHQTILSSRDSRNSLRSNFSSRESESSRSNTQP
GFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTRRLLSRIASSMSSTFFSRRSS
QDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRFLRRRWGLSSL
SHNHSSESDSENFNQESEGRNTGPWLSSSLRNRCTPLFSRRRREGRDESSRIPTSDTSSR
SHIFRRESNEVVHLEAQNDPLGAAANRPQASAASSSATTGGSTSDSAQGGRNTGISGILP
GSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIKESLL
LEDSEEEEGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEA
VTTCELCKEKLELNLEDFDIHELHRAHANEQAEYEFISSGLYLVVLLHLCEQSFSDMMGN
TNEPSTRVRFINLARTLQAHMEDLETSEDDSEEDGDHNRTFDIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H992	1.000	1.000	1.793E-96	704	1.000	1.000	Q9H992.pdb.gz	MARH7_HUMAN E3 ubiquitin-protein ligase MARCHF7 OS=Homo sapiens OX=9606 GN=MARCHF7 PE=1 SV=1
2	AFDB:Q9WV66	0.312	0.317	1.486E-78	693	0.838	0.851	Q9WV66.pdb.gz	MARH7_MOUSE E3 ubiquitin-protein ligase MARCHF7 OS=Mus musculus OX=10090 GN=Marchf7 PE=2 SV=1
3	AFDB:Q8NA82	0.193	0.169	6.985E-16	808	0.257	0.224	Q8NA82.pdb.gz	MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCHF10 OS=Homo sapiens OX=9606 GN=MARCHF10 PE=1 SV=3
4	PDB:7od1A	0.086	0.134	1.583E-2	430	0.023	0.037	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
5	PDB:8a3tU	0.083	0.361	1.801E-2	114	0.030	0.184	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
6	AFDB:O01299	0.053	0.050	6.623E-2	762	0.112	0.104	O01299.pdb.gz	O01299_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F09C8.2 PE=1 SV=2
7	PDB:7oniH	0.086	0.149	7.915E-2	380	0.023	0.042	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
8	PDB:7kzpL	0.085	0.146	9.601E-2	370	0.036	0.068	7kzpL.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
9	AFDB:Q6ZQD9	0.046	0.042	1.108E-1	824	0.115	0.098	Q6ZQD9.pdb.gz	Q6ZQD9_MOUSE MKIAA0311 protein (Fragment) OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
10	AFDB:A0A1D8PFD3	0.083	0.061	1.182E-1	1001	0.131	0.092	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
11	PDB:3m62A	0.074	0.057	1.413E-1	955	0.024	0.018	3m62A.pdb.gz
12	AFDB:Q63364	0.060	0.060	1.739E-1	707	0.132	0.132	Q63364.pdb.gz	PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus OX=10116 GN=Pja2 PE=2 SV=1
13	AFDB:A0A0K3AUE4	0.057	0.024	2.559E-1	1968	0.163	0.058	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
14	AFDB:Q96QE3	0.059	0.029	2.729E-1	1844	0.118	0.045	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
15	AFDB:Q5BIH1	0.063	0.057	3.104E-1	803	0.155	0.136	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
16	PDB:2lgvA	0.055	0.298	5.821E-1	100	0.030	0.210	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
17	PDB:5lj5t	0.065	0.096	1.433	438	0.030	0.048	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	PDB:5gm6a	0.059	0.260	1.529	123	0.017	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6tdaL	0.079	0.089	3.309	596	0.030	0.035	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
20	PDB:5gmkq	0.075	0.125	3.764	387	0.026	0.047	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H992	0.0	1425	704	1.000	1.000	MARH7_HUMAN E3 ubiquitin-protein ligase MARCHF7 OS=Homo sapiens OX=9606 GN=MARCHF7 PE=1 SV=1
2	Q9WV66	0.0	1028	693	0.832	0.846	MARH7_MOUSE E3 ubiquitin-protein ligase MARCHF7 OS=Mus musculus OX=10090 GN=Marchf7 PE=2 SV=1
3	Q8NA82	6.64e-31	131	808	0.115	0.100	MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCHF10 OS=Homo sapiens OX=9606 GN=MARCHF10 PE=1 SV=3
4	O60103	8.54e-10	64.7	1242	0.043	0.024	DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=doa10 PE=1 SV=1
5	D6REN1	1.74e-07	53.1	141	0.034	0.170	D6REN1_HUMAN Membrane associated ring-CH-type finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
6	P40318	7.04e-07	55.5	1319	0.033	0.017	DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSM4 PE=1 SV=1
7	Q9DBD2	1.22e-06	53.1	286	0.036	0.087	MARH8_MOUSE E3 ubiquitin-protein ligase MARCHF8 OS=Mus musculus OX=10090 GN=Marchf8 PE=2 SV=1
8	Q8TCQ1	1.28e-06	53.1	289	0.041	0.100	MARH1_HUMAN E3 ubiquitin-protein ligase MARCHF1 OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
9	Q6NZQ8	1.36e-06	53.1	289	0.034	0.083	MARH1_MOUSE E3 ubiquitin-protein ligase MARCHF1 OS=Mus musculus OX=10090 GN=Marchf1 PE=1 SV=2
10	B8A530	1.41e-06	52.8	282	0.036	0.089	B8A530_DANRE E3 ubiquitin-protein ligase MARCH8 isoform 1 OS=Danio rerio OX=7955 GN=march8 PE=4 SV=1
11	Q5T0T0	1.76e-06	52.8	291	0.036	0.086	MARH8_HUMAN E3 ubiquitin-protein ligase MARCHF8 OS=Homo sapiens OX=9606 GN=MARCHF8 PE=1 SV=1
12	D6RGC4	3.00e-06	52.8	545	0.033	0.042	D6RGC4_HUMAN Membrane associated ring-CH-type finger 1 OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
13	O60337	3.23e-06	53.1	910	0.034	0.026	MARH6_HUMAN E3 ubiquitin-protein ligase MARCHF6 OS=Homo sapiens OX=9606 GN=MARCHF6 PE=1 SV=2
14	Q400N4	6.95e-06	52.0	1025	0.033	0.022	Q400N4_CAEEL RING-CH-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=marc-6 PE=1 SV=2
15	Q57V79	1.00e-05	51.6	873	0.045	0.037	Q57V79_TRYB2 RING-CH-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.100 PE=4 SV=1
16	Q9FJJ6	3.40e-05	48.9	307	0.038	0.088	Q9FJJ6_ARATH AT5g62460/K19B1_7 OS=Arabidopsis thaliana OX=3702 GN=RZFP PE=1 SV=1
17	F4JKK0	4.98e-05	49.3	1108	0.033	0.021	SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana OX=3702 GN=SUD1 PE=1 SV=1
18	Q9P0N8	9.49e-05	47.0	246	0.043	0.122	MARH2_HUMAN E3 ubiquitin-protein ligase MARCHF2 OS=Homo sapiens OX=9606 GN=MARCHF2 PE=1 SV=1
19	Q9SN83	9.61e-05	47.4	288	0.037	0.090	Q9SN83_ARATH RING/FYVE/PHD zinc finger superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.100 PE=1 SV=1
20	P90489	1.44e-04	46.6	256	0.034	0.094	MIR2_HHV8P E3 ubiquitin-protein ligase MIR2 OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=K5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17309 DUF5356	27	16.1	Family of unknown function (DUF5356)
2	PF11793 FANCL_C	49	15.6	FANCL C-terminal domain
3	PF12906 RINGv	4.3e-12	57.3	RING-variant domain
4	PF13639 zf-RING_2	24	16.7	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261427	0.905	Ubiquitin-conjugating enzyme E2 K
2	9606.ENSP00000343535	0.836	Ubiquitin carboxyl-terminal hydrolase 7
3	9606.ENSP00000316357	0.768	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
4	9606.ENSP00000316176	0.690	Ubiquitin-conjugating enzyme E2 N
5	9606.ENSP00000345974	0.677	Mitochondrial enolase superfamily member 1
6	9606.ENSP00000341551	0.666	Mothers against decapentaplegic homolog 4
7	9606.ENSP00000265260	0.665	PEST proteolytic signal-containing nuclear protein
8	9606.ENSP00000331487	0.643	Nuclear protein localization protein 4 homolog
9	9606.ENSP00000338348	0.637	Ubiquitin-conjugating enzyme E2 G2
10	9606.ENSP00000267273	0.621	Protein-lysine methyltransferase METTL21C
11	9606.ENSP00000365924	0.617	E3 ubiquitin-protein ligase TRIM31
12	9606.ENSP00000296051	0.600	Hermansky-Pudlak syndrome 3 protein
13	9606.ENSP00000351813	0.599	E3 ubiquitin-protein ligase MARCH5
14	9606.ENSP00000309141	0.598	E3 ubiquitin-protein ligase MARCH3
15	9606.ENSP00000333181	0.597	E3 ubiquitin-protein ligase MARCH11
16	9606.ENSP00000471536	0.587	E3 ubiquitin-protein ligase MARCH2
17	9606.ENSP00000381140	0.574	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
18	9606.ENSP00000241502	0.567	UAP56-interacting factor
19	9606.ENSP00000417601	0.560	F-box/LRR-repeat protein 2
20	9606.ENSP00000273067	0.557	E3 ubiquitin-protein ligase MARCH4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031624	0.998	ubiquitin conjugating enzyme binding
GO:0097371	0.936	MDM2/MDM4 family protein binding
GO:0140096	0.807	catalytic activity, acting on a protein
GO:0016740	0.781	transferase activity
GO:0019787	0.746	ubiquitin-like protein transferase activity
GO:0004842	0.742	ubiquitin-protein transferase activity
GO:0061630	0.439	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0019538	0.988	protein metabolic process
GO:0023051	0.978	regulation of signaling
GO:0048583	0.977	regulation of response to stimulus
GO:0080090	0.976	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0051246	0.970	regulation of protein metabolic process
GO:0048523	0.964	negative regulation of cellular process
GO:0010646	0.955	regulation of cell communication
GO:0009966	0.943	regulation of signal transduction
GO:0048518	0.929	positive regulation of biological process
GO:0032446	0.907	protein modification by small protein conjugation
GO:0016567	0.904	protein ubiquitination
GO:0048585	0.883	negative regulation of response to stimulus
GO:0051865	0.842	protein autoubiquitination
GO:0048522	0.837	positive regulation of cellular process
GO:0009987	0.814	cellular process
GO:0051173	0.806	positive regulation of nitrogen compound metabolic process
GO:0009894	0.801	regulation of catabolic process
GO:0010604	0.799	positive regulation of macromolecule metabolic process
GO:0009892	0.786	negative regulation of metabolic process
GO:0010605	0.756	negative regulation of macromolecule metabolic process
GO:0042176	0.752	regulation of protein catabolic process
GO:1903320	0.741	regulation of protein modification by small protein conjugation or removal
GO:1902531	0.711	regulation of intracellular signal transduction
GO:0051172	0.691	negative regulation of nitrogen compound metabolic process
GO:1901796	0.685	regulation of signal transduction by p53 class mediator
GO:0009968	0.678	negative regulation of signal transduction
GO:0042127	0.676	regulation of cell population proliferation
GO:0051248	0.658	negative regulation of protein metabolic process
GO:0051239	0.606	regulation of multicellular organismal process
GO:0030162	0.555	regulation of proteolysis
GO:1903050	0.546	regulation of proteolysis involved in protein catabolic process
GO:0031647	0.533	regulation of protein stability
GO:0044237	0.523	cellular metabolic process
GO:0031396	0.510	regulation of protein ubiquitination
GO:0061136	0.501	regulation of proteasomal protein catabolic process
GO:1901797	0.483	negative regulation of signal transduction by p53 class mediator
GO:0031400	0.482	negative regulation of protein modification process
GO:0042981	0.480	regulation of apoptotic process
GO:0031323	0.450	regulation of cellular metabolic process
GO:2001233	0.443	regulation of apoptotic signaling pathway
GO:0080134	0.442	regulation of response to stress
GO:0051247	0.422	positive regulation of protein metabolic process
GO:0080135	0.333	regulation of cellular response to stress
GO:0050896	0.331	response to stimulus
GO:1903321	0.308	negative regulation of protein modification by small protein conjugation or removal
GO:2001020	0.307	regulation of response to DNA damage stimulus
GO:0060548	0.303	negative regulation of cell death
GO:1901799	0.300	negative regulation of proteasomal protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.988	cytoplasm
GO:0005829	0.981	cytosol
GO:0016020	0.966	membrane
GO:0005886	0.734	plasma membrane
GO:0070013	0.396	intracellular organelle lumen
GO:0031981	0.383	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.781	Transferases.

[back to server]