StarFunc result for job id Q9H999

User Input

>input (370 residues)
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGS
TGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYK
FEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLD
DPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNN
IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAV
GALLGLPNFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2W9	0.996	0.996	9.125E-77	370	0.992	0.992	Q8R2W9.pdb.gz	PANK3_MOUSE Pantothenate kinase 3 OS=Mus musculus OX=10090 GN=Pank3 PE=1 SV=1
2	PDB:5kprA	0.965	0.994	1.562E-70	359	0.962	0.992	5kprA.pdb.gz	Allosteric Regulation of Mammalian Pantothenate Kinase.
3	AFDB:Q9BZ23	0.971	0.632	1.543E-68	570	0.816	0.530	Q9BZ23.pdb.gz	PANK2_HUMAN Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3
4	AFDB:Q8K4K6	0.976	0.661	2.770E-67	548	0.789	0.533	Q8K4K6.pdb.gz	PANK1_MOUSE Pantothenate kinase 1 OS=Mus musculus OX=10090 GN=Pank1 PE=1 SV=1
5	AFDB:A0A2R8Q6D9	0.968	0.958	7.396E-67	374	0.776	0.767	A0A2R8Q6D9.pdb.gz
6	AFDB:Q8TE04	0.971	0.603	8.795E-67	598	0.784	0.485	Q8TE04.pdb.gz	PANK1_HUMAN Pantothenate kinase 1 OS=Homo sapiens OX=9606 GN=PANK1 PE=1 SV=2
7	AFDB:B8A4W8	0.969	0.821	4.696E-66	437	0.784	0.664	B8A4W8.pdb.gz	B8A4W8_DANRE Pantothenate kinase 2 OS=Danio rerio OX=7955 GN=zgc:158667 PE=4 SV=1
8	AFDB:Q9NHN2	0.947	0.687	2.263E-56	512	0.614	0.443	Q9NHN2.pdb.gz	Q9NHN2_DROME Fumble OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
9	PDB:5kqdA	0.768	0.903	8.206E-50	312	0.835	0.990	5kqdA.pdb.gz	Allosteric Regulation of Mammalian Pantothenate Kinase.
10	AFDB:G5EAY3	0.729	0.646	4.031E-34	420	0.346	0.305	G5EAY3.pdb.gz	G5EAY3_EMENI Pantothenate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09446 PE=4 SV=1
11	AFDB:O80765	0.760	0.735	1.016E-33	383	0.341	0.329	O80765.pdb.gz	PANK1_ARATH Pantothenate kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PANK1 PE=1 SV=2
12	AFDB:Q8L5Y9	0.767	0.328	1.076E-33	901	0.319	0.131	Q8L5Y9.pdb.gz	PANK2_ARATH Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PANK2 PE=1 SV=2
13	PDB:7t1hA	0.728	0.785	2.401E-30	342	0.303	0.327	7t1hA.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
14	PDB:7t1iB	0.700	0.818	1.615E-29	314	0.308	0.363	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
15	PDB:5eouA	0.337	0.369	9.062E-8	333	0.130	0.144	5eouA.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
16	PDB:6z81A	0.451	0.481	3.840E-7	342	0.114	0.123	6z81A.pdb.gz	Structure of a reaction intermediate mimic in t6A biosynthesis bound in the active site of the TsaBD heterodimer from Escherichia coli.
17	PDB:4ehtA	0.447	0.589	4.838E-7	268	0.111	0.153	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
18	PDB:2aa4A	0.372	0.455	5.431E-7	289	0.135	0.173	2aa4A.pdb.gz	Crystal Structure of Escherichia Coli Putative N-Acetylmannosamine Kinase
19	PDB:5eq6A	0.403	0.416	5.431E-7	357	0.130	0.134	5eq6A.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
20	PDB:6w6eI	0.393	0.405	1.025E-6	357	0.146	0.151	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YF29	0.0	621	403	0.814	0.747	A0A2R8YF29_HUMAN Pantothenate kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=1
2	B8A4W8	0.0	595	437	0.784	0.664	B8A4W8_DANRE Pantothenate kinase 2 OS=Danio rerio OX=7955 GN=zgc:158667 PE=4 SV=1
3	F1QB40	0.0	570	373	0.786	0.780	F1QB40_DANRE Pantothenate kinase 1a OS=Danio rerio OX=7955 GN=fb79e08 PE=4 SV=1
4	Q7M753	0.0	625	456	0.811	0.658	PANK2_MOUSE Pantothenate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Pank2 PE=1 SV=1
5	Q8K4K6	0.0	600	548	0.786	0.531	PANK1_MOUSE Pantothenate kinase 1 OS=Mus musculus OX=10090 GN=Pank1 PE=1 SV=1
6	Q8R2W9	0.0	759	370	0.992	0.992	PANK3_MOUSE Pantothenate kinase 3 OS=Mus musculus OX=10090 GN=Pank3 PE=1 SV=1
7	Q8TE04	0.0	596	598	0.784	0.485	PANK1_HUMAN Pantothenate kinase 1 OS=Homo sapiens OX=9606 GN=PANK1 PE=1 SV=2
8	Q9BZ23	0.0	626	570	0.816	0.530	PANK2_HUMAN Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3
9	Q9H999	0.0	764	370	1.000	1.000	PANK3_HUMAN Pantothenate kinase 3 OS=Homo sapiens OX=9606 GN=PANK3 PE=1 SV=1
10	Q9VPG4	1.78e-169	481	419	0.608	0.537	Q9VPG4_DROME Fumble, isoform A OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
11	Q9VPG5	3.88e-169	480	417	0.605	0.537	Q9VPG5_DROME Fumble, isoform B OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
12	Q8I0S6	9.49e-169	478	401	0.605	0.559	Q8I0S6_DROME AT20009p OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
13	M9NDE0	1.04e-168	479	428	0.605	0.523	M9NDE0_DROME Fumble, isoform G OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
14	Q9NHN2	4.43e-168	481	512	0.608	0.439	Q9NHN2_DROME Fumble OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
15	D8FT20	1.94e-137	397	342	0.503	0.544	D8FT20_DROME Fumble, isoform F OS=Drosophila melanogaster OX=7227 GN=fbl PE=1 SV=1
16	G5EAY3	2.13e-61	204	420	0.322	0.283	G5EAY3_EMENI Pantothenate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09446 PE=4 SV=1
17	Q8L5Y9	3.77e-56	199	901	0.343	0.141	PANK2_ARATH Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PANK2 PE=1 SV=2
18	O74962	3.03e-47	167	403	0.316	0.290	PANK_SCHPO Pantothenate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4B4.01c PE=1 SV=1
19	O80765	4.23e-47	166	383	0.357	0.345	PANK1_ARATH Pantothenate kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PANK1 PE=1 SV=2
20	Q04430	2.28e-40	148	367	0.295	0.297	PANK_YEAST Pantothenate kinase CAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03630 Fumble	1.3e-109	378.0	Fumble

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005558535.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005543802.1	0.992	Phosphopantothenoylcysteine synthetase
2	9541.XP_005560167.1	0.967	Phosphopantothenoylcysteine decarboxylase isoform X1
3	9541.XP_005584312.1	0.965	Bifunctional coenzyme A synthase
4	9541.XP_005551917.1	0.919	Uncharacterized protein
5	9541.XP_005551918.1	0.910	LOW QUALITY PROTEIN: vascular non-inflammatory molecule 3-like
6	9541.XP_005551919.1	0.910	Uncharacterized protein
7	9541.XP_005551904.1	0.902	Uncharacterized protein
8	9541.XP_005551906.1	0.902	Uncharacterized protein
9	9541.XP_005565977.1	0.811	Uncharacterized protein
10	9541.XP_005595172.1	0.591	Uncharacterized protein
11	9541.XP_005546029.1	0.565	Uncharacterized protein
12	9541.XP_005592072.1	0.565	Protein FAM192A isoform X1
13	9541.XP_005581296.1	0.540	Uncharacterized protein
14	9541.XP_005584931.1	0.536	Uncharacterized protein
15	9541.XP_005545156.1	0.516	Segment polarity protein dishevelled homolog DVL-1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004594	0.999	pantothenate kinase activity
GO:0005515	0.987	protein binding
GO:0097159	0.594	organic cyclic compound binding
GO:1901363	0.576	heterocyclic compound binding
GO:0043167	0.500	ion binding
GO:0042802	0.426	identical protein binding
GO:0043168	0.373	anion binding
GO:0097367	0.345	carbohydrate derivative binding
GO:0036094	0.345	small molecule binding
GO:0032559	0.337	adenyl ribonucleotide binding
GO:1901681	0.335	sulfur compound binding
GO:0042803	0.335	protein homodimerization activity
GO:0120227	0.333	acyl-CoA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0044281	0.992	small molecule metabolic process
GO:0006139	0.987	nucleobase-containing compound metabolic process
GO:0006796	0.986	phosphate-containing compound metabolic process
GO:0019637	0.985	organophosphate metabolic process
GO:0072521	0.979	purine-containing compound metabolic process
GO:0006753	0.979	nucleoside phosphate metabolic process
GO:0009150	0.971	purine ribonucleotide metabolic process
GO:0090407	0.969	organophosphate biosynthetic process
GO:0034654	0.968	nucleobase-containing compound biosynthetic process
GO:1901137	0.965	carbohydrate derivative biosynthetic process
GO:0015936	0.956	coenzyme A metabolic process
GO:0009152	0.956	purine ribonucleotide biosynthetic process
GO:0034033	0.954	purine nucleoside bisphosphate biosynthetic process
GO:0034030	0.952	ribonucleoside bisphosphate biosynthetic process
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.965	cytosol
GO:0043226	0.462	organelle
GO:0043229	0.382	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16373	0.999	(R)-pantothenate + ATP = (R)-4'-phosphopantothenate + ADP + H(+)
EC:2.7.1.33	0.999	pantothenate kinase.

[back to server]