StarFunc result for job id Q9H9A5

User Input

>input (744 residues)
MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDD
YKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVIL
YHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMIS
QGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIK
SVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLLTNKRYELLYN
CGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPK
QENGAKNSNQLGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSA
YVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVT
DVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYD
KARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLALQIIKRNQLLPAVKTHSEVRK
KPVFQPVHPIQPIQMPAFTTVQRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9A5	1.000	1.000	3.754E-91	744	1.000	1.000	Q9H9A5.pdb.gz	CNO10_HUMAN CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10 PE=1 SV=1
2	AFDB:Q9V3G6	0.629	0.730	1.400E-20	635	0.222	0.260	Q9V3G6.pdb.gz	CNO10_DROME CCR4-NOT transcription complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=Not10 PE=1 SV=1
3	AFDB:Q6PGP7	0.175	0.088	1.145E-9	1564	0.151	0.072	Q6PGP7.pdb.gz	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
4	AFDB:Q57WP4	0.282	0.306	1.396E-9	673	0.112	0.123	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
5	AFDB:Q96AY4	0.321	0.129	9.733E-9	2481	0.136	0.041	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
6	AFDB:Q7KJA9	0.312	0.241	1.566E-8	1059	0.101	0.071	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
7	AFDB:Q9UJX2	0.340	0.402	1.909E-8	597	0.113	0.141	Q9UJX2.pdb.gz	CDC23_HUMAN Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3
8	AFDB:Q7T0N9	0.348	0.421	2.237E-8	580	0.106	0.136	Q7T0N9.pdb.gz	Q7T0N9_XENLA Cell division cycle 23 L homeolog OS=Xenopus laevis OX=8355 GN=cdc23.L PE=1 SV=1
9	AFDB:A0A2R8PZ91	0.304	0.224	2.838E-8	1119	0.105	0.070	A0A2R8PZ91.pdb.gz
10	AFDB:Q386Y0	0.288	0.273	2.838E-8	800	0.132	0.122	Q386Y0.pdb.gz	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1
11	PDB:7qe7J	0.300	0.376	2.587E-7	510	0.102	0.149	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:4bujB	0.280	0.176	2.800E-7	1367	0.098	0.053	4bujB.pdb.gz
13	PDB:8a3tJ	0.292	0.389	3.281E-7	509	0.114	0.167	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:7qe7K	0.252	0.327	4.162E-7	531	0.090	0.126	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:8a3tD	0.358	0.449	4.330E-7	560	0.094	0.125	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:7qdrB	0.331	0.232	4.688E-7	1212	0.106	0.065	7qdrB.pdb.gz
17	PDB:7qe7U	0.351	0.447	6.967E-7	540	0.110	0.152	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:6tedQ	0.218	0.190	7.847E-7	890	0.106	0.089	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:7dkhI	0.346	0.291	1.121E-6	914	0.091	0.074	7dkhI.pdb.gz
20	PDB:7kzpG	0.231	0.283	1.602E-6	577	0.109	0.140	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H9A5	0.0	1544	744	1.000	1.000	CNO10_HUMAN CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10 PE=1 SV=1
2	Q9V3G6	1.33e-36	148	635	0.173	0.203	CNO10_DROME CCR4-NOT transcription complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=Not10 PE=1 SV=1
3	D6QXI6	0.14	37.4	288	0.046	0.118	D6QXI6_WHEAT Heme oxygenase 1 OS=Triticum aestivum OX=4565 GN=HO1 PE=2 SV=1
4	M9PCJ7	2.4	33.9	934	0.022	0.017	M9PCJ7_DROME Utx histone demethylase, isoform E OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
5	Q76NQ3	2.4	33.9	939	0.022	0.017	Q76NQ3_DROME Utx histone demethylase, isoform B OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
6	M9MRG4	3.1	33.9	1130	0.022	0.014	M9MRG4_DROME Utx histone demethylase, isoform D OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
7	P13508	3.1	33.9	1295	0.027	0.015	GLP1_CAEEL Protein glp-1 OS=Caenorhabditis elegans OX=6239 GN=glp-1 PE=1 SV=1
8	Q9VL07	3.2	33.9	1136	0.022	0.014	Q9VL07_DROME LD02225p OS=Drosophila melanogaster OX=7227 GN=Utx PE=2 SV=3
9	Q38AA1	3.3	33.5	555	0.035	0.047	Q38AA1_TRYB2 CCR4-NOT transcription complex subunit 10 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1820 PE=3 SV=1
10	Q69XJ4	3.3	33.1	289	0.040	0.104	HMOX1_ORYSJ Heme oxygenase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=HO1 PE=2 SV=1
11	Q9Y148	4.5	33.1	1011	0.040	0.030	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
12	Q9C9L4	4.8	32.7	285	0.042	0.109	HMOX3_ARATH Heme oxygenase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HO3 PE=1 SV=1
13	Q7KJA9	5.6	32.7	1059	0.040	0.028	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
14	O23155	8.7	32.0	492	0.039	0.059	O23155_ARATH At4g37330 OS=Arabidopsis thaliana OX=3702 GN=CYP81D4 PE=1 SV=1
15	F4I9D5	9.6	32.0	592	0.040	0.051	F4I9D5_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=FEI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	11	17.7	Anaphase-promoting complex, cyclosome, subunit 3
2	PF19531 DUF6058	4e+02	12.7	Family of unknown function (DUF6058)
3	PF06103 DUF948	3.6e+02	12.8	Bacterial protein of unknown function (DUF948)
4	PF17004 SRP_TPR_like	2.8	19.3	Putative TPR-like repeat
5	PF00515 TPR_1	7.3e-09	46.3	Tetratricopeptide repeat
6	PF13374 TPR_10	1.2	20.3	Tetratricopeptide repeat
7	PF13424 TPR_12	0.00056	31.5	Tetratricopeptide repeat
8	PF13428 TPR_14	0.0068	28.1	Tetratricopeptide repeat
9	PF13432 TPR_16	4.1e+02	13.0	Tetratricopeptide repeat
10	PF13431 TPR_17	13	17.5	Tetratricopeptide repeat
11	PF14559 TPR_19	0.041	25.7	Tetratricopeptide repeat
12	PF07719 TPR_2	2.2e-06	38.4	Tetratricopeptide repeat
13	PF13174 TPR_6	88	15.2	Tetratricopeptide repeat
14	PF13176 TPR_7	0.21	22.7	Tetratricopeptide repeat
15	PF13181 TPR_8	2.4	19.6	Tetratricopeptide repeat
16	PF17874 TPR_MalT	11	16.8	MalT-like TPR region
17	PF01014 Uricase	2.8e+02	13.2	Uricase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000025390

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000061148	0.963	CCR4-NOT transcription complex, subunit 7
2	9598.ENSPTRP00000057878	0.957	CCR4-NOT transcription complex, subunit 2
3	9598.ENSPTRP00000021054	0.954	Uncharacterized protein
4	9598.ENSPTRP00000013973	0.942	CCR4-NOT transcription complex, subunit 1
5	9598.ENSPTRP00000029810	0.924	CCR4-NOT transcription complex subunit 8
6	9598.ENSPTRP00000022087	0.889	Uncharacterized protein
7	9598.ENSPTRP00000040630	0.884	CCR4-NOT transcription complex, subunit 3
8	9598.ENSPTRP00000046345	0.879	Tankyrase 1 binding protein 1
9	9598.ENSPTRP00000027832	0.873	CCR4-NOT transcription complex, subunit 6-like
10	9598.ENSPTRP00000033796	0.858	Uncharacterized protein
11	9598.ENSPTRP00000030128	0.849	CCR4-NOT transcription complex, subunit 6
12	9598.ENSPTRP00000048224	0.682	poly(A) binding protein interacting protein 1
13	9598.ENSPTRP00000003136	0.679	BTG family, member 2
14	9598.ENSPTRP00000026995	0.662	Uncharacterized protein
15	9598.ENSPTRP00000016565	0.656	Uncharacterized protein
16	9598.ENSPTRP00000041427	0.655	Polyadenylate-binding protein
17	9598.ENSPTRP00000027042	0.651	Pan troglodytes eukaryotic translation initiation factor 4A2 (EIF4A2), mRNA
18	9598.ENSPTRP00000014825	0.641	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon (By similarity)
19	9598.ENSPTRP00000015989	0.625	Transducer of ERBB2, 1
20	9598.ENSPTRP00000003315	0.614	Angel homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.968	regulation of biological process
GO:0050794	0.958	regulation of cellular process
GO:0019222	0.886	regulation of metabolic process
GO:0008152	0.872	metabolic process
GO:0071704	0.823	organic substance metabolic process
GO:0043170	0.793	macromolecule metabolic process
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0044238	0.745	primary metabolic process
GO:0006807	0.718	nitrogen compound metabolic process
GO:0044237	0.685	cellular metabolic process
GO:0048519	0.589	negative regulation of biological process
GO:0010468	0.570	regulation of gene expression
GO:0031323	0.562	regulation of cellular metabolic process
GO:0080090	0.526	regulation of primary metabolic process
GO:0051171	0.522	regulation of nitrogen compound metabolic process
GO:0048523	0.520	negative regulation of cellular process
GO:0009892	0.510	negative regulation of metabolic process
GO:0046483	0.497	heterocycle metabolic process
GO:0010605	0.492	negative regulation of macromolecule metabolic process
GO:0006725	0.478	cellular aromatic compound metabolic process
GO:0009889	0.472	regulation of biosynthetic process
GO:0090304	0.468	nucleic acid metabolic process
GO:0010556	0.462	regulation of macromolecule biosynthetic process
GO:0031326	0.437	regulation of cellular biosynthetic process
GO:0010608	0.434	post-transcriptional regulation of gene expression
GO:0031324	0.382	negative regulation of cellular metabolic process
GO:0016070	0.378	RNA metabolic process
GO:0051172	0.366	negative regulation of nitrogen compound metabolic process
GO:0051246	0.361	regulation of protein metabolic process
GO:0010629	0.350	negative regulation of gene expression
GO:0010558	0.333	negative regulation of macromolecule biosynthetic process
GO:0031327	0.315	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0030014	0.998	CCR4-NOT complex
GO:0043226	0.970	organelle
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005634	0.954	nucleus
GO:0005654	0.782	nucleoplasm
GO:0043228	0.732	non-membrane-bounded organelle
GO:0043232	0.487	intracellular non-membrane-bounded organelle
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]