StarFunc result for job id Q9H9B1

User Input

>input (1298 residues)
MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCEN
SDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVI
GSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLG
EGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKN
ISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVP
KKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDD
GHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSES
SIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYM
EVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQC
MATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNF
MECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKG
SALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETL
ESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAA
AEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGS
TCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDIN
IRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLS
RDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYER
IPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSM
RCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGV
RSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFIN
HHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGS
PKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K889	0.649	0.654	0.000	1289	0.887	0.893	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
2	AFDB:A2ABF9	0.221	0.226	0.000	1267	0.454	0.465	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
3	AFDB:Q9H9B1	1.000	1.000	0.000	1298	1.000	1.000	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
4	PDB:8cs9A	0.190	0.308	9.525E-20	796	0.062	0.101	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	PDB:2dvwA	0.163	0.868	1.110E-16	229	0.049	0.275	2dvwA.pdb.gz
6	PDB:1pegA	0.168	0.769	1.279E-15	266	0.063	0.308	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
7	PDB:4oauC	0.185	0.336	7.681E-15	692	0.053	0.100	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
8	PDB:5vkqA	0.167	0.146	4.869E-14	1499	0.055	0.048	5vkqA.pdb.gz
9	PDB:1wg0A	0.149	0.596	5.428E-14	243	0.049	0.259	1wg0A.pdb.gz
10	PDB:6v9hC	0.148	0.609	7.519E-14	270	0.049	0.237	6v9hC.pdb.gz
11	PDB:6aunA	0.180	0.357	6.971E-13	618	0.049	0.102	6aunA.pdb.gz
12	AFDB:Q54HC6	0.158	0.142	1.655E-11	1460	0.113	0.101	Q54HC6.pdb.gz	ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum OX=44689 GN=arkA PE=1 SV=1
13	AFDB:Q8IBB0	0.155	0.087	4.645E-11	2399	0.153	0.083	Q8IBB0.pdb.gz	Q8IBB0_PLAF7 SET domain protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0827800 PE=4 SV=1
14	PDB:6jd6B	0.118	0.752	5.375E-11	192	0.035	0.234	6jd6B.pdb.gz
15	AFDB:Q9VW15	0.158	0.096	1.453E-10	2226	0.170	0.099	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
16	PDB:7td5A	0.106	0.262	2.090E-10	497	0.055	0.145	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	AFDB:Q2LAE1	0.138	0.104	7.413E-10	1759	0.156	0.115	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
18	AFDB:Q9VYD1	0.144	0.086	1.674E-9	2313	0.158	0.089	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
19	AFDB:A4LBC2	0.133	0.109	5.531E-9	1604	0.126	0.102	A4LBC2.pdb.gz	A4LBC2_CAEEL Histone-lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=met-1 PE=1 SV=1
20	AFDB:Q8IE95	0.139	0.077	9.018E-9	2548	0.156	0.079	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024RCN9	1075	1210	0.396	0.425	A0A024RCN9_HUMAN EHMT2 OS=Homo sapiens OX=9606 PE=4 SV=1
2	A0A0D9SEQ1	868	432	0.332	0.998	A0A0D9SEQ1_HUMAN Euchromatic histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
3	A0A0G2JTA5	1057	1172	0.375	0.416	A0A0G2JTA5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
4	A0A0G2JZM5	1083	1206	0.404	0.434	A0A0G2JZM5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
5	A0A0G2K889	2287	1302	0.880	0.877	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
6	A0A1B0GU48	2012	981	0.756	1.000	A0A1B0GU48_HUMAN Euchromatic histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
7	A0A1B0GUD1	1113	556	0.423	0.987	A0A1B0GUD1_HUMAN Euchromatic histone lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
8	A0A1B0GV09	2638	1267	0.976	1.000	A0A1B0GV09_HUMAN Euchromatic histone lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
9	A0A1B0GVZ8	1075	543	0.408	0.976	A0A1B0GVZ8_HUMAN Euchromatic histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
10	A0A8I6AB09	2314	1302	0.888	0.885	A0A8I6AB09_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
11	A0A8I6ABS0	2217	1243	0.861	0.899	A0A8I6ABS0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
12	A0A8I6ANQ0	2258	1276	0.871	0.886	A0A8I6ANQ0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
13	A0A8J8XWH8	992	1241	0.380	0.397	A0A8J8XWH8_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
14	A2ABF8	1050	1233	0.367	0.387	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
15	A2ABF9	1075	1267	0.396	0.406	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
16	A8TT22	959	1173	0.361	0.399	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
17	D4A005	2293	1285	0.883	0.892	D4A005_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=4
18	Q5DW34	2311	1296	0.888	0.890	EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus OX=10090 GN=Ehmt1 PE=1 SV=2
19	Q6MG72	1083	1263	0.404	0.415	Q6MG72_RAT HLA-B associated transcript 8, rat orthologue OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
20	Q96KQ7	1075	1210	0.396	0.425	EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-29	112.5	Ankyrin repeat
2	PF12796 Ank_2	3.7e-42	154.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6e-30	110.8	Ankyrin repeat
4	PF13637 Ank_4	5.8e-38	140.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.6e-29	111.7	Ankyrin repeats (many copies)
6	PF05033 Pre-SET	5.1e-13	61.0	Pre-SET motif
7	PF00856 SET	6.1e-19	80.5	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364678	0.980	Histone-lysine N-methyltransferase EHMT2
2	9606.ENSP00000270722	0.973	PR domain zinc finger protein 16
3	9606.ENSP00000269305	0.965	Cellular tumor antigen p53
4	9606.ENSP00000332194	0.937	Histone H2A type 2-C
5	9606.ENSP00000358151	0.933	Histone H2B type 2-E
6	9606.ENSP00000296417	0.932	Histone H2A.Z
7	9606.ENSP00000308405	0.926	Histone H2A.V
8	9606.ENSP00000274764	0.922	Histone H2B type 1-A
9	9606.ENSP00000434024	0.919	Histone H2AX
10	9606.ENSP00000438553	0.917	Histone H2A.J
11	9606.ENSP00000345571	0.916	Transcription factor E2F1
12	9606.ENSP00000481622	0.916	Histone H2B type F-S
13	9606.ENSP00000484261	0.915	Histone H2A-Bbd type 1
14	9606.ENSP00000349430	0.914	Histone H2B type 1-K
15	9606.ENSP00000367022	0.913	Histone H2A type 1-C
16	9606.ENSP00000328484	0.912	Histone H2A type 1-J
17	9606.ENSP00000341094	0.912	Histone H2A type 1-D
18	9606.ENSP00000289316	0.911	Histone H2B type 1-D
19	9606.ENSP00000366618	0.911	Histone H2B type 1-L
20	9606.ENSP00000476136	0.911	Histone H2B type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0008134	0.979	transcription factor binding
GO:0002039	0.924	p53 binding
GO:0001222	0.905	transcription corepressor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0071704	0.921	organic substance metabolic process
GO:0044238	0.915	primary metabolic process
GO:0050789	0.875	regulation of biological process
GO:0006807	0.840	nitrogen compound metabolic process
GO:0016043	0.830	cellular component organization
GO:0050794	0.819	regulation of cellular process
GO:0019222	0.796	regulation of metabolic process
GO:0008213	0.794	protein alkylation
GO:0044237	0.792	cellular metabolic process
GO:0060255	0.786	regulation of macromolecule metabolic process
GO:0043414	0.701	macromolecule methylation
GO:0080090	0.674	regulation of primary metabolic process
GO:0051171	0.674	regulation of nitrogen compound metabolic process
GO:0050896	0.618	response to stimulus
GO:0006325	0.617	chromatin organization
GO:0031323	0.558	regulation of cellular metabolic process
GO:0019219	0.536	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.507	regulation of gene expression
GO:0048519	0.454	negative regulation of biological process
GO:0051252	0.408	regulation of RNA metabolic process
GO:0010556	0.398	regulation of macromolecule biosynthetic process
GO:0031326	0.390	regulation of cellular biosynthetic process
GO:2001141	0.365	regulation of RNA biosynthetic process
GO:0006355	0.364	regulation of DNA-templated transcription
GO:0010605	0.352	negative regulation of macromolecule metabolic process
GO:0048523	0.325	negative regulation of cellular process
GO:0048518	0.303	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016604	0.766	nuclear body
GO:0032991	0.453	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]