StarFunc result for job id Q9H9D4

User Input

>input (720 residues)
MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRDILALKSLPRG
LALGPSLAKEQRLGVWCVGDPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDV
CACEQSSGWTSLVQRGRLESEGNVAPVRISERLHLQVYQLVLPGSELLLWPQPSSEGPSL
TQPGLDKEAAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFP
TQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQ
PHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGK
AFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYGT
QRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQ
GSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELR
RHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKS
HLEDKPYRCPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLD
THREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9D4	1.000	1.000	0.000	720	1.000	1.000	Q9H9D4.pdb.gz	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1
2	AFDB:E7FAN3	0.303	0.288	4.790E-50	764	0.408	0.385	E7FAN3.pdb.gz	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
3	AFDB:Q09FC8	0.231	0.267	2.766E-31	603	0.206	0.245	Q09FC8.pdb.gz	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
4	AFDB:A0A024R4S7	0.223	0.209	1.222E-29	792	0.203	0.184	A0A024R4S7.pdb.gz
5	AFDB:Q8R2V3	0.122	0.096	3.966E-25	986	0.210	0.153	Q8R2V3.pdb.gz	ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus OX=10090 GN=Znf445 PE=2 SV=2
6	AFDB:Q9Y2L8	0.217	0.193	5.064E-25	839	0.204	0.175	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
7	AFDB:P41183	0.168	0.171	2.418E-19	707	0.197	0.201	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
8	AFDB:Q9VI93	0.134	0.110	9.638E-17	946	0.197	0.150	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
9	AFDB:F1R5N6	0.176	0.176	3.696E-16	718	0.169	0.170	F1R5N6.pdb.gz	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
10	AFDB:Q921B4	0.097	0.087	2.505E-14	824	0.158	0.138	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
11	PDB:3w5kB	0.079	0.287	3.265E-4	110	0.049	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2g46A	0.083	0.397	1.083E-1	119	0.024	0.143	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	PDB:5h6zA	0.086	0.423	1.471E-1	123	0.024	0.138	5h6zA.pdb.gz
14	PDB:7td5F	0.088	0.138	4.417E-1	447	0.018	0.029	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:5hynA	0.095	0.115	4.992E-1	581	0.021	0.026	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
16	PDB:6o9lQ	0.044	0.062	5.641E-1	430	0.074	0.123	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7td5A	0.089	0.125	1.039	497	0.018	0.026	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:7uhyC	0.048	0.055	1.105	578	0.042	0.052	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:3qxyA	0.046	0.078	1.174	420	0.008	0.014	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
20	PDB:6gejS	0.041	0.107	1.327	208	0.040	0.139	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H9D4	0.0	1449	720	1.000	1.000	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1
2	E7FAN3	2.81e-167	501	764	0.422	0.398	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
3	P52737	7.00e-76	256	540	0.168	0.224	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
4	Q49A12	3.00e-74	251	536	0.168	0.226	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
5	Q8NA42	3.89e-74	249	475	0.210	0.318	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
6	Q03923	4.32e-74	253	595	0.168	0.203	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
7	Q03936	6.41e-74	252	586	0.156	0.191	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
8	P35789	1.00e-72	249	620	0.153	0.177	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
9	Q96EQ9	1.87e-72	254	843	0.231	0.197	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
10	Q8TD23	3.22e-72	247	568	0.154	0.195	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
11	Q99PJ6	3.84e-72	251	736	0.163	0.159	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
12	Q8N9F8	5.41e-72	245	522	0.182	0.251	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
13	Q14929	1.13e-71	246	603	0.183	0.219	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
14	Q3V362	2.85e-71	246	622	0.172	0.199	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
15	Q6PCX8	5.92e-71	245	632	0.172	0.196	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
16	Q3USU9	6.29e-71	245	632	0.172	0.196	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
17	Q08ER8	8.02e-71	244	600	0.157	0.188	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
18	P51814	1.05e-70	248	821	0.163	0.143	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
19	Q9P0L1	1.59e-70	247	754	0.178	0.170	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
20	E9QAG8	1.61e-70	241	526	0.161	0.221	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09947 DUF2180	2.7e+02	12.9	Uncharacterized protein conserved in archaea (DUF2180)
2	PF12773 DZR	0.056	24.8	Double zinc ribbon
3	PF09237 GAGA	72	14.8	GAGA factor
4	PF07754 HVO_2753_ZBP	1.5	20.0	Small zinc finger protein HVO_2753-like, Zn-binding pocket
5	PF01155 HypA	5.3	18.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
6	PF00096 zf-C2H2	2.3e-37	136.5	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	2.3e-07	41.8	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	4.7e-33	122.0	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	2.2e-15	67.5	C2H2-type zinc finger
10	PF16293 zf-C2H2_9	9.9e+02	11.0	C2H2 type zinc-finger (1 copy)
11	PF12171 zf-C2H2_jaz	7.5e-15	66.0	Zinc-finger double-stranded RNA-binding
12	PF16278 zf-C2HE	0.0077	28.0	C2HE / C2H2 / C2HC zinc-binding finger
13	PF05605 zf-Di19	4.7e-05	34.9	Drought induced 19 protein (Di19), zinc-binding
14	PF13465 zf-H2C2_2	1.1e-50	179.2	Zinc-finger double domain
15	PF12874 zf-met	0.00092	30.7	Zinc-finger of C2H2 type
16	PF17032 zinc_ribbon_15	2.2e+02	14.0	zinc-ribbon family
17	PF09723 Zn-ribbon_8	0.0066	27.9	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	12	17.3	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309606

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222747	0.825	Tetraspanin-12
2	9606.ENSP00000434034	0.721	Frizzled-4
3	9606.ENSP00000193391	0.690	Interphotoreceptor matrix proteoglycan 2
4	9606.ENSP00000443551	0.671	Mevalonate kinase
5	9606.ENSP00000252809	0.660	Growth differentiation factor 15
6	9606.ENSP00000367301	0.651	Norrin
7	9606.ENSP00000260731	0.646	Kinesin-like protein KIF11
8	9606.ENSP00000435373	0.636	Cyclin-J
9	9606.ENSP00000442688	0.633	Molybdate-anion transporter
10	9606.ENSP00000294304	0.631	Low-density lipoprotein receptor-related protein 5
11	9606.ENSP00000222286	0.627	Glyceraldehyde-3-phosphate dehydrogenase, testis-specific
12	9606.ENSP00000385689	0.622	GRAM domain-containing protein 4
13	9606.ENSP00000368720	0.609	Controls the stability of the leptin mRNA harboring an AU- rich element (ARE) in its 3' UTR, in cooperation with the RNA stabilizer ELAVL1 . Decreases the stability of the leptin mRNA by antagonizing the function of ELAVL1 by inducing its atypical recruitment from the nucleus to the cytosol (By similarity). Binds to cardiolipin (CL), phosphatidic acid (PA), phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylserine (PS) . Promotes apoptosis by enhancing BAX-BAK hetero-oligomerization via interaction with BID in colon cancer cells (By similarity). ECO:0000269\|PubMed:18191643, [...]
14	9606.ENSP00000303942	0.601	Platelet glycoprotein IX
15	9606.ENSP00000367552	0.600	RCC1 and BTB domain-containing protein 1
16	9606.ENSP00000342313	0.579	Sterile alpha motif domain-containing protein 11
17	9606.ENSP00000367878	0.559	UPF0705 protein C11orf49
18	9606.ENSP00000405252	0.556	A-kinase anchor protein 7 isoform gamma
19	9606.ENSP00000369320	0.553	Retinoschisin
20	9606.ENSP00000442308	0.537	NF-kappa-B-repressing factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0097159	0.599	organic cyclic compound binding
GO:1901363	0.598	heterocyclic compound binding
GO:0003676	0.308	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009889	0.995	regulation of biosynthetic process
GO:0010468	0.995	regulation of gene expression
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0048518	0.950	positive regulation of biological process
GO:0048522	0.851	positive regulation of cellular process
GO:0009987	0.833	cellular process
GO:0031325	0.825	positive regulation of cellular metabolic process
GO:0045935	0.771	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.706	positive regulation of macromolecule metabolic process
GO:0051254	0.699	positive regulation of RNA metabolic process
GO:0031328	0.680	positive regulation of cellular biosynthetic process
GO:0010557	0.677	positive regulation of macromolecule biosynthetic process
GO:0045893	0.673	positive regulation of DNA-templated transcription
GO:0048519	0.655	negative regulation of biological process
GO:0048523	0.566	negative regulation of cellular process
GO:0006357	0.535	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.802	nucleoplasm
GO:0005737	0.732	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]