StarFunc result for job id Q9H9E1

User Input

>input (313 residues)
MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRF
DMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTT
KHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDE
EGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVD
VNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVI
ESHLLKLLQNIKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9E1	1.000	1.000	4.748E-44	313	1.000	1.000	Q9H9E1.pdb.gz	ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens OX=9606 GN=ANKRA2 PE=1 SV=1
2	AFDB:A0A024R7M1	0.520	0.624	1.050E-20	260	0.425	0.512	A0A024R7M1.pdb.gz
3	AFDB:Q9Z205	0.526	0.610	1.470E-20	269	0.422	0.491	Q9Z205.pdb.gz	RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus OX=10090 GN=Rfxank PE=1 SV=1
4	AFDB:Q3KN55	0.496	0.229	2.445E-12	697	0.195	0.088	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
5	AFDB:Q9SQK3	0.470	0.468	3.294E-11	315	0.214	0.213	Q9SQK3.pdb.gz	EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB506 PE=1 SV=1
6	AFDB:Q8N9V6	0.483	0.291	4.843E-11	530	0.185	0.109	Q8N9V6.pdb.gz	ANR53_HUMAN Ankyrin repeat domain-containing protein 53 OS=Homo sapiens OX=9606 GN=ANKRD53 PE=1 SV=3
7	AFDB:Q4VBW1	0.482	0.664	1.332E-10	226	0.144	0.199	Q4VBW1.pdb.gz
8	AFDB:Q96Q27	0.453	0.246	1.866E-10	587	0.141	0.075	Q96Q27.pdb.gz	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
9	PDB:6jd6B	0.482	0.765	2.053E-10	192	0.163	0.266	6jd6B.pdb.gz
10	AFDB:A0A384NYH5	0.444	0.436	2.156E-10	319	0.185	0.182	A0A384NYH5.pdb.gz	A0A384NYH5_HUMAN Ankyrin repeat domain 1 (Cardiac muscle) OS=Homo sapiens OX=9606 GN=ANKRD1 PE=2 SV=1
11	AFDB:Q812A3	0.445	0.455	2.374E-10	306	0.182	0.186	Q812A3.pdb.gz	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
12	PDB:2dvwA	0.479	0.651	2.490E-10	229	0.166	0.227	2dvwA.pdb.gz
13	PDB:8cs9A	0.473	0.189	1.553E-9	796	0.131	0.052	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:1bd8A	0.449	0.871	2.662E-8	156	0.121	0.244	1bd8A.pdb.gz
15	PDB:4oauC	0.436	0.204	5.225E-8	692	0.141	0.064	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:6mwqA	0.428	0.276	1.507E-7	493	0.144	0.091	6mwqA.pdb.gz
17	PDB:6v9xA	0.443	0.247	1.660E-7	571	0.141	0.077	6v9xA.pdb.gz
18	PDB:6v9hC	0.452	0.521	1.742E-7	270	0.134	0.156	6v9hC.pdb.gz
19	PDB:1bu9A	0.440	0.783	2.687E-7	168	0.118	0.220	1bu9A.pdb.gz
20	PDB:1wg0A	0.466	0.597	3.587E-7	243	0.105	0.136	1wg0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99PE2	0.0	621	312	0.949	0.952	ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus OX=10090 GN=Ankra2 PE=1 SV=1
2	Q9H9E1	0.0	652	313	1.000	1.000	ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens OX=9606 GN=ANKRA2 PE=1 SV=1
3	O14593	6.82e-82	250	260	0.393	0.473	RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=2
4	Q9Z205	5.09e-80	246	269	0.390	0.454	RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus OX=10090 GN=Rfxank PE=1 SV=1
5	A0A024R7P0	3.18e-70	219	237	0.351	0.464	A0A024R7P0_HUMAN Regulatory factor X associated ankyrin containing protein OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=1
6	F5GY33	4.16e-48	161	188	0.259	0.431	F5GY33_HUMAN Regulatory factor X associated ankyrin containing protein (Fragment) OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=2
7	K7ENE6	1.15e-22	93.6	145	0.144	0.310	K7ENE6_HUMAN Regulatory factor X associated ankyrin containing protein (Fragment) OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=1
8	E9Q9B7	3.92e-19	90.5	1793	0.160	0.028	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
9	A0A1Y7VME9	3.98e-19	90.5	1763	0.160	0.028	A0A1Y7VME9_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
10	B2RXL7	4.03e-19	90.5	1672	0.160	0.030	B2RXL7_MOUSE Kidins220 protein OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
11	Q9EQG6	4.13e-19	90.5	1762	0.160	0.028	KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2
12	A0A1Y7VMH7	4.46e-19	90.1	1672	0.160	0.030	A0A1Y7VMH7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
13	Q9ULH0	4.63e-19	90.1	1771	0.160	0.028	KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3
14	H0YM23	2.35e-17	85.1	2487	0.166	0.021	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
15	O75179	2.49e-17	85.1	2603	0.166	0.020	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
16	Q99NH0	2.78e-17	85.1	2603	0.166	0.020	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
17	Q6PHD6	1.03e-16	82.4	452	0.137	0.095	Q6PHD6_DANRE Integrin-linked protein kinase OS=Danio rerio OX=7955 GN=zgc:65842 PE=1 SV=1
18	Q13418	1.86e-15	78.6	452	0.150	0.104	ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2
19	V9HWF0	1.86e-15	78.6	452	0.150	0.104	V9HWF0_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=HEL-S-28 PE=2 SV=1
20	Q9C0D5	1.87e-15	79.3	1861	0.169	0.028	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.5e-16	70.5	Ankyrin repeat
2	PF12796 Ank_2	2.8e-23	93.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.4e-17	70.8	Ankyrin repeat
4	PF13637 Ank_4	2.5e-15	67.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2e-18	77.5	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264606	0.998	Histone deacetylase 4
2	9606.ENSP00000303158	0.985	Coiled-coil domain-containing protein 8
3	9606.ENSP00000225983	0.984	Histone deacetylase 5
4	9606.ENSP00000263816	0.958	Low-density lipoprotein receptor-related protein 2
5	9606.ENSP00000453281	0.926	DNA-binding protein RFX7
6	9606.ENSP00000445247	0.910	Proline-rich protein 19
7	9606.ENSP00000290524	0.789	DNA-binding protein RFX5
8	9606.ENSP00000323816	0.717	Aryl hydrocarbon receptor repressor
9	9606.ENSP00000386213	0.711	Myosin-IIIb
10	9606.ENSP00000302967	0.689	Histone deacetylase 3
11	9606.ENSP00000255476	0.687	Regulatory factor X-associated protein
12	9606.ENSP00000296792	0.610	U3 small nucleolar RNA-associated protein 15 homolog
13	9606.ENSP00000307636	0.599	MORN repeat-containing protein 4
14	9606.ENSP00000441913	0.596	Rho guanine nucleotide exchange factor 28
15	9606.ENSP00000396857	0.592	Zinc finger protein 697
16	9606.ENSP00000429015	0.559	Ankyrin repeat domain-containing protein 46
17	9606.ENSP00000479518	0.529	Unconventional myosin-XIX
18	9606.ENSP00000256447	0.525	CD180 antigen
19	9606.ENSP00000349274	0.517	Protein phosphatase 1 regulatory subunit 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042826	0.999	histone deacetylase binding
GO:0070325	0.434	lipoprotein particle receptor binding
GO:0050750	0.424	low-density lipoprotein particle receptor binding
GO:0019901	0.389	protein kinase binding
GO:0044389	0.366	ubiquitin-like protein ligase binding
GO:0031625	0.300	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051128	0.713	regulation of cellular component organization
GO:0009987	0.670	cellular process
GO:0044087	0.518	regulation of cellular component biogenesis
GO:0048518	0.517	positive regulation of biological process
GO:0043254	0.513	regulation of protein-containing complex assembly
GO:0048522	0.491	positive regulation of cellular process
GO:0050896	0.428	response to stimulus
GO:0019222	0.381	regulation of metabolic process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0080090	0.350	regulation of primary metabolic process
GO:0051171	0.350	regulation of nitrogen compound metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0010468	0.326	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.997	membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.990	nucleus
GO:0032991	0.983	protein-containing complex
GO:0005829	0.971	cytosol
GO:0071944	0.517	cell periphery
GO:0005886	0.467	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]