StarFunc result for job id Q9H9F9

User Input

>input (607 residues)
MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQ
FRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSM
CSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSY
IQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYP
KDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDW
ALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
GGAGEQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9F9	1.000	1.000	0.000	607	1.000	1.000	Q9H9F9.pdb.gz	ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens OX=9606 GN=ACTR5 PE=1 SV=2
2	AFDB:Q80US4	0.902	0.905	1.226E-103	605	0.890	0.893	Q80US4.pdb.gz	ARP5_MOUSE Actin-related protein 5 OS=Mus musculus OX=10090 GN=Actr5 PE=1 SV=3
3	AFDB:Q9VEC3	0.645	0.605	9.208E-55	648	0.359	0.336	Q9VEC3.pdb.gz	ARP5_DROME Actin-related protein 5 OS=Drosophila melanogaster OX=7227 GN=Arp5 PE=1 SV=1
4	AFDB:Q9Y7X8	0.649	0.549	1.312E-45	721	0.329	0.277	Q9Y7X8.pdb.gz	ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp5 PE=1 SV=1
5	PDB:6htsH	0.516	0.944	1.654E-42	326	0.532	0.991	6htsH.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
6	AFDB:Q940Z2	0.603	0.509	9.108E-42	724	0.305	0.256	Q940Z2.pdb.gz	ARP5_ARATH Actin-related protein 5 OS=Arabidopsis thaliana OX=3702 GN=ARP5 PE=1 SV=2
7	AFDB:P53946	0.660	0.535	2.715E-41	755	0.300	0.241	P53946.pdb.gz	ARP5_YEAST Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP5 PE=1 SV=1
8	AFDB:P10989	0.526	0.834	3.496E-27	375	0.180	0.291	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
9	AFDB:P07828	0.538	0.841	6.732E-27	380	0.176	0.282	P07828.pdb.gz	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
10	AFDB:Q8RYC2	0.546	0.858	7.509E-27	378	0.191	0.307	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
11	AFDB:P0CJ46	0.548	0.862	1.446E-26	377	0.188	0.302	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
12	PDB:1c0gA	0.535	0.862	7.343E-26	368	0.175	0.288	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
13	PDB:1yagA	0.535	0.852	5.243E-25	372	0.173	0.282	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
14	PDB:4cbxA	0.534	0.885	5.537E-25	358	0.180	0.304	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:6tu4A	0.523	0.836	5.537E-25	372	0.170	0.277	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
16	PDB:4pl7A	0.521	0.813	1.439E-21	382	0.166	0.264	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
17	PDB:4a7fA	0.519	0.818	1.211E-20	375	0.180	0.291	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
18	PDB:6gejR	0.518	0.749	6.947E-20	411	0.130	0.192	6gejR.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:6w17A	0.525	0.814	3.205E-19	380	0.150	0.239	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
20	PDB:3dwlA	0.453	0.727	2.288E-18	355	0.153	0.262	3dwlA.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80US4	0.0	1047	605	0.876	0.879	ARP5_MOUSE Actin-related protein 5 OS=Mus musculus OX=10090 GN=Actr5 PE=1 SV=3
2	Q9H9F9	0.0	1253	607	1.000	1.000	ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens OX=9606 GN=ACTR5 PE=1 SV=2
3	Q9VEC3	2.13e-89	291	648	0.244	0.228	ARP5_DROME Actin-related protein 5 OS=Drosophila melanogaster OX=7227 GN=Arp5 PE=1 SV=1
4	Q9Y7X8	1.35e-56	205	721	0.206	0.173	ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp5 PE=1 SV=1
5	Q940Z2	9.22e-55	200	724	0.201	0.169	ARP5_ARATH Actin-related protein 5 OS=Arabidopsis thaliana OX=3702 GN=ARP5 PE=1 SV=2
6	P53946	5.25e-45	172	755	0.198	0.159	ARP5_YEAST Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP5 PE=1 SV=1
7	P07828	4.75e-19	91.7	380	0.086	0.137	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
8	P53492	7.42e-19	90.9	377	0.114	0.183	ACT7_ARATH Actin-7 OS=Arabidopsis thaliana OX=3702 GN=ACT7 PE=1 SV=1
9	Q8ILW9	1.04e-18	90.5	376	0.114	0.184	ACT2_PLAF7 Actin-2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ACT2 PE=3 SV=1
10	P0CJ46	1.93e-18	89.7	377	0.082	0.133	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
11	P0CJ47	1.93e-18	89.7	377	0.082	0.133	ACT3_ARATH Actin-3 OS=Arabidopsis thaliana OX=3702 GN=ACT3 PE=1 SV=1
12	P53496	2.51e-18	89.4	377	0.082	0.133	ACT11_ARATH Actin-11 OS=Arabidopsis thaliana OX=3702 GN=ACT11 PE=1 SV=1
13	Q55EU6	3.31e-18	89.0	358	0.077	0.131	ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum OX=44689 GN=act23 PE=1 SV=1
14	P20359	4.68e-18	88.6	375	0.112	0.181	ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=acnA PE=3 SV=2
15	Q96293	5.28e-18	88.6	377	0.115	0.186	ACT8_ARATH Actin-8 OS=Arabidopsis thaliana OX=3702 GN=ACT8 PE=1 SV=2
16	P53498	5.38e-18	88.6	377	0.112	0.180	ACT_CHLRE Actin OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
17	Q96292	5.43e-18	88.6	377	0.115	0.186	ACT2_ARATH Actin-2 OS=Arabidopsis thaliana OX=3702 GN=ACT2 PE=1 SV=1
18	Q4KMI7	7.97e-18	87.8	377	0.079	0.127	Q4KMI7_DANRE Actin, alpha 1b, skeletal muscle OS=Danio rerio OX=7955 GN=actc PE=1 SV=1
19	P68133	1.17e-17	87.4	377	0.079	0.127	ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens OX=9606 GN=ACTA1 PE=1 SV=1
20	P68134	1.17e-17	87.4	377	0.079	0.127	ACTS_MOUSE Actin, alpha skeletal muscle OS=Mus musculus OX=10090 GN=Acta1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	8.6e-44	161.4	Actin
2	PF07564 DUF1542	18	16.8	Domain of Unknown Function (DUF1542)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233331	0.999	INO80 complex subunit B
2	9606.ENSP00000318297	0.999	RuvB-like 1
3	9606.ENSP00000336842	0.999	Actin-related protein 8
4	9606.ENSP00000355205	0.999	DNA helicase INO80
5	9606.ENSP00000391457	0.999	Chromosome 18 open reading frame 37, isoform CRA_a
6	9606.ENSP00000473172	0.999	RuvB-like 2
7	9606.ENSP00000436926	0.997	Nuclear factor related to kappa-B-binding protein
8	9606.ENSP00000467041	0.995	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair
9	9606.ENSP00000397552	0.990	Actin-like protein 6A
10	9606.ENSP00000457016	0.986	INO80 complex subunit E
11	9606.ENSP00000356425	0.979	Ubiquitin carboxyl-terminal hydrolase isozyme L5
12	9606.ENSP00000262238	0.976	Transcriptional repressor protein YY1
13	9606.ENSP00000349640	0.967	Microspherule protein 1
14	9606.ENSP00000375639	0.967	TCF3 fusion partner
15	9606.ENSP00000303373	0.960	Histone cluster 1 H2A family member e
16	9606.ENSP00000476136	0.956	Histone H2B type 1-J
17	9606.ENSP00000352252	0.947	Histone cluster 1 H3 family member j
18	9606.ENSP00000367034	0.947	Histone cluster 1 H4 family member c
19	9606.ENSP00000374213	0.937	E1A-binding protein p400
20	9606.ENSP00000301764	0.933	DNA damage-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0048518	0.986	positive regulation of biological process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0051052	0.982	regulation of DNA metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0033044	0.978	regulation of chromosome organization
GO:1901360	0.976	organic cyclic compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0006139	0.974	nucleobase-containing compound metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0071840	0.964	cellular component organization or biogenesis
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0051173	0.955	positive regulation of nitrogen compound metabolic process
GO:0031325	0.952	positive regulation of cellular metabolic process
GO:0016043	0.939	cellular component organization
GO:0045935	0.925	positive regulation of nucleobase-containing compound metabolic process
GO:0006259	0.903	DNA metabolic process
GO:0051054	0.887	positive regulation of DNA metabolic process
GO:0080135	0.868	regulation of cellular response to stress
GO:0050896	0.835	response to stimulus
GO:0006325	0.820	chromatin organization
GO:0009889	0.815	regulation of biosynthetic process
GO:0010556	0.799	regulation of macromolecule biosynthetic process
GO:2001020	0.790	regulation of response to DNA damage stimulus
GO:0051716	0.781	cellular response to stimulus
GO:2001252	0.781	positive regulation of chromosome organization
GO:0048584	0.739	positive regulation of response to stimulus
GO:0009314	0.734	response to radiation
GO:0032206	0.675	positive regulation of telomere maintenance
GO:0006282	0.660	regulation of DNA repair
GO:0006338	0.653	chromatin remodeling
GO:0031326	0.604	regulation of cellular biosynthetic process
GO:0032200	0.603	telomere organization
GO:0051726	0.553	regulation of cell cycle
GO:0000723	0.553	telomere maintenance
GO:0045995	0.544	regulation of embryonic development
GO:0006950	0.517	response to stress
GO:0051252	0.505	regulation of RNA metabolic process
GO:0010468	0.492	regulation of gene expression
GO:2001141	0.487	regulation of RNA biosynthetic process
GO:0006355	0.475	regulation of DNA-templated transcription
GO:0104004	0.467	cellular response to environmental stimulus
GO:0009891	0.465	positive regulation of biosynthetic process
GO:0031328	0.462	positive regulation of cellular biosynthetic process
GO:0010557	0.448	positive regulation of macromolecule biosynthetic process
GO:0045893	0.434	positive regulation of DNA-templated transcription
GO:2001022	0.406	positive regulation of response to DNA damage stimulus
GO:0045739	0.388	positive regulation of DNA repair
GO:0006974	0.371	cellular response to DNA damage stimulus
GO:0006275	0.322	regulation of DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0140513	0.997	nuclear protein-containing complex
GO:0005694	0.996	chromosome
GO:1902494	0.987	catalytic complex
GO:0000785	0.987	chromatin
GO:0070603	0.980	SWI/SNF superfamily-type complex
GO:0097346	0.972	INO80-type complex
GO:0000228	0.968	nuclear chromosome
GO:0031011	0.961	Ino80 complex
GO:0005829	0.345	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]