StarFunc result for job id Q9H9G7

User Input

>input (860 residues)
MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPR
RVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRP
FKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGR
SFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLD
IHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE
NGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN
QTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISK
DAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTL
LGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRF
KPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCAD
RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEL
QLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP
QALAKAVQIHQDTLRTMYFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4krfA	0.936	0.985	0.000	817	0.807	0.849	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
2	PDB:4w5tA	0.910	0.969	0.000	807	0.763	0.813	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
3	PDB:5vm9C	0.891	0.975	0.000	785	0.909	0.996	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
4	PDB:5weaA	0.858	0.963	0.000	764	0.724	0.815	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
5	PDB:6oonA	0.901	0.987	0.000	785	0.760	0.833	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
6	AFDB:E7EXY4	0.963	0.949	0.000	873	0.800	0.788	E7EXY4.pdb.gz
7	AFDB:G5EES3	0.963	0.811	0.000	1023	0.671	0.564	G5EES3.pdb.gz	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
8	AFDB:O16720	0.963	0.910	0.000	910	0.658	0.622	O16720.pdb.gz	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
9	AFDB:Q32KD4	0.968	0.847	0.000	984	0.728	0.636	Q32KD4.pdb.gz	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	AFDB:Q8CJF8	0.973	0.972	0.000	861	0.812	0.811	Q8CJF8.pdb.gz	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
11	AFDB:Q8CJF9	0.998	0.998	0.000	860	0.990	0.990	Q8CJF9.pdb.gz	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
12	AFDB:Q8CJG1	0.973	0.976	0.000	857	0.844	0.847	Q8CJG1.pdb.gz	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
13	AFDB:D6RUV9	0.911	0.742	6.366E-102	1061	0.455	0.369	D6RUV9.pdb.gz	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
14	AFDB:Q9XGW1	0.910	0.796	9.311E-102	988	0.442	0.385	Q9XGW1.pdb.gz	AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana OX=3702 GN=AGO10 PE=1 SV=1
15	AFDB:O04379	0.898	0.743	1.157E-101	1048	0.452	0.371	O04379.pdb.gz	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
16	PDB:7swfA	0.714	0.783	3.081E-79	778	0.407	0.450	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
17	PDB:5guhA	0.681	0.763	6.360E-57	759	0.227	0.257	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
18	PDB:6kr6A	0.615	0.728	6.445E-50	713	0.205	0.247	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
19	PDB:7kpvD	0.460	0.453	3.086E-13	876	0.100	0.098	7kpvD.pdb.gz
20	PDB:1r6zZ	0.120	0.201	2.210E-5	499	0.048	0.082	1r6zZ.pdb.gz	The crystal structure of the Argonaute2 PAZ domain reveals an RNA binding motif in RNAi effector complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PTZ8	1524	891	0.838	0.809	A0A6I8PTZ8_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
2	D6RUV9	688	1061	0.448	0.363	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
3	G5EES3	1199	1023	0.670	0.563	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
4	G5EGR6	1198	1002	0.673	0.578	G5EGR6_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
5	K4I874	1451	873	0.799	0.787	K4I874_DANRE Protein argonaute-2 OS=Danio rerio OX=7955 GN=AGO2 PE=1 SV=1
6	O04379	696	1048	0.448	0.367	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
7	O16720	1162	910	0.663	0.626	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
8	Q27IR0	1221	851	0.695	0.703	Q27IR0_DROME Argonaute-1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
9	Q32KD4	1286	984	0.729	0.637	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	Q5TA58	1433	782	0.786	0.864	Q5TA58_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
11	Q69VD5	689	979	0.436	0.383	PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica OX=39947 GN=PHN1 PE=2 SV=1
12	Q7KY08	1285	950	0.729	0.660	Q7KY08_DROME Argonaute protein OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
13	Q851R2	652	1058	0.433	0.352	MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica OX=39947 GN=MEL1 PE=2 SV=1
14	Q86B39	1162	891	0.663	0.640	Q86B39_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=1
15	Q8CJF8	1442	861	0.810	0.810	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
16	Q8CJF9	1778	860	0.990	0.990	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
17	Q8CJG0	1442	860	0.794	0.794	AGO2_MOUSE Protein argonaute-2 OS=Mus musculus OX=10090 GN=Ago2 PE=1 SV=3
18	Q8CJG1	1523	857	0.838	0.841	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
19	Q8T059	704	424	0.393	0.797	Q8T059_DROME LD26301p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1
20	Q960T1	944	601	0.531	0.760	Q960T1_DROME LD36719p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	4.8e-19	79.1	Argonaute linker 1 domain
2	PF16488 ArgoL2	3.5e-08	44.9	Argonaute linker 2 domain
3	PF16487 ArgoMid	7.9e-29	111.1	Mid domain of argonaute
4	PF16486 ArgoN	1.2e-21	89.1	N-terminal domain of argonaute
5	PF02170 PAZ	1.5e-25	101.3	PAZ domain
6	PF02171 Piwi	2.5e-110	380.1	Piwi domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010358714.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352005.1	0.987	Belongs to the helicase family. Dicer subfamily.
2	61622.XP_010366169.1	0.974	Trinucleotide repeat containing 6A
3	61622.XP_010372198.1	0.966	Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1
4	61622.XP_010383748.1	0.952	Argonaute 2, RISC catalytic component
5	61622.XP_010377795.1	0.948	Trinucleotide repeat containing 6B
6	61622.XP_010358711.1	0.943	Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs
7	61622.XP_010358713.1	0.943	Belongs to the argonaute family.
8	61622.XP_010380818.1	0.931	Protein activator of interferon induced protein kinase EIF2AK2
9	61622.XP_010365776.1	0.926	DEAD-box helicase 6
10	61622.XP_010376321.1	0.919	Drosha ribonuclease III
11	61622.XP_010380213.1	0.914	Trinucleotide repeat-containing gene 6C protein
12	61622.XP_010377027.1	0.892	Endonuclease that mediates miRNA decay of both protein-free and AGO2-loaded miRNAs
13	61622.XP_010367227.1	0.888	DExH-box helicase 9
14	61622.XP_010363832.1	0.863	Eukaryotic translation initiation factor 4E
15	61622.XP_010386736.1	0.848	Microprocessor complex subunit DGCR8
16	61622.XP_010368037.1	0.843	Exportin-5
17	61622.XP_010360655.1	0.830	DNA-directed RNA polymerase II subunit RPB1
18	61622.XP_010374121.1	0.829	Decapping mRNA 2
19	61622.XP_010379494.1	0.810	UBX domain-containing protein 7
20	61622.XP_010351404.1	0.809	M-phase phosphoprotein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035198	0.999	miRNA binding
GO:0003824	0.942	catalytic activity
GO:0140098	0.878	catalytic activity, acting on RNA
GO:0004540	0.837	ribonuclease activity
GO:0004521	0.823	RNA endonuclease activity
GO:0016891	0.790	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0003727	0.737	single-stranded RNA binding
GO:0003725	0.677	double-stranded RNA binding
GO:0019899	0.649	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0048519	0.994	negative regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0043170	0.990	macromolecule metabolic process
GO:1901360	0.983	organic cyclic compound metabolic process
GO:0046483	0.983	heterocycle metabolic process
GO:0006725	0.983	cellular aromatic compound metabolic process
GO:0034641	0.983	cellular nitrogen compound metabolic process
GO:0010605	0.983	negative regulation of macromolecule metabolic process
GO:0010468	0.982	regulation of gene expression
GO:2000112	0.979	regulation of cellular macromolecule biosynthetic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0016441	0.961	post-transcriptional gene silencing
GO:0070918	0.961	regulatory ncRNA processing
GO:0034248	0.960	regulation of amide metabolic process
GO:0051246	0.956	regulation of protein metabolic process
GO:0035196	0.952	miRNA processing
GO:0035194	0.949	RNA-mediated post-transcriptional gene silencing
GO:0010558	0.948	negative regulation of macromolecule biosynthetic process
GO:0031327	0.947	negative regulation of cellular biosynthetic process
GO:0035195	0.944	miRNA-mediated gene silencing
GO:0051172	0.943	negative regulation of nitrogen compound metabolic process
GO:0071840	0.938	cellular component organization or biogenesis
GO:2000113	0.931	negative regulation of cellular macromolecule biosynthetic process
GO:0048518	0.907	positive regulation of biological process
GO:0048522	0.902	positive regulation of cellular process
GO:0006417	0.893	regulation of translation
GO:0051248	0.883	negative regulation of protein metabolic process
GO:0017148	0.835	negative regulation of translation
GO:0009893	0.820	positive regulation of metabolic process
GO:0010604	0.704	positive regulation of macromolecule metabolic process
GO:0019219	0.611	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.599	cellular component organization
GO:0051252	0.599	regulation of RNA metabolic process
GO:0051173	0.584	positive regulation of nitrogen compound metabolic process
GO:0031325	0.583	positive regulation of cellular metabolic process
GO:0032502	0.386	developmental process
GO:0032501	0.386	multicellular organismal process
GO:0045935	0.338	positive regulation of nucleobase-containing compound metabolic process
GO:0048856	0.329	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0035770	0.992	ribonucleoprotein granule
GO:1990904	0.990	ribonucleoprotein complex
GO:0036464	0.983	cytoplasmic ribonucleoprotein granule
GO:0031332	0.975	RNAi effector complex
GO:0016442	0.973	RISC complex
GO:0031974	0.965	membrane-enclosed lumen
GO:0031981	0.964	nuclear lumen
GO:0005654	0.910	nucleoplasm
GO:1902494	0.891	catalytic complex
GO:0140535	0.850	intracellular protein-containing complex
GO:0016020	0.799	membrane
GO:1905348	0.708	endonuclease complex
GO:1902555	0.688	endoribonuclease complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.838	Acting on ester bonds.
EC:3.1.26.-	0.790	Endoribonucleases producing 5'-phosphomonoesters.

[back to server]