StarFunc result for job id Q9H9H5

User Input

>input (199 residues)
MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDS
GRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPI
GDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKK
FTPNPSAIFQASAPRILNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14BB9	0.532	0.551	1.182E-18	191	0.734	0.764	Q14BB9.pdb.gz	MA6D1_MOUSE MAP6 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Map6d1 PE=1 SV=1
2	AFDB:Q96JE9	0.147	0.043	1.132E-2	813	0.337	0.082	Q96JE9.pdb.gz	MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens OX=9606 GN=MAP6 PE=1 SV=2
3	AFDB:Q63560	0.130	0.036	1.942E-2	952	0.302	0.063	Q63560.pdb.gz	MAP6_RAT Microtubule-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Map6 PE=1 SV=1
4	AFDB:Q7TSJ2	0.150	0.041	8.579E-2	906	0.302	0.066	Q7TSJ2.pdb.gz	MAP6_MOUSE Microtubule-associated protein 6 OS=Mus musculus OX=10090 GN=Map6 PE=1 SV=2
5	AFDB:Q05DH4	0.144	0.036	3.763	1040	0.176	0.034	Q05DH4.pdb.gz	FHI1A_HUMAN FHF complex subunit HOOK-interacting protein 1A OS=Homo sapiens OX=9606 GN=FHIP1A PE=1 SV=2
6	AFDB:Q38C20	0.108	0.052	3.763	588	0.211	0.071	Q38C20.pdb.gz	Q38C20_TRYB2 NTF2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5500 PE=4 SV=1
7	AFDB:Q9HC52	0.095	0.063	3.763	389	0.196	0.100	Q9HC52.pdb.gz	CBX8_HUMAN Chromobox protein homolog 8 OS=Homo sapiens OX=9606 GN=CBX8 PE=1 SV=3
8	AFDB:O14200	0.143	0.072	5.642	495	0.156	0.063	O14200.pdb.gz	PXA1_SCHPO PXA domain protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pxa1 PE=2 SV=1
9	AFDB:O46341	0.119	0.067	5.642	409	0.206	0.100	O46341.pdb.gz	A6_DROME Protein a6 OS=Drosophila melanogaster OX=7227 GN=a6 PE=1 SV=1
10	AFDB:Q5VWT5	0.141	0.046	5.642	728	0.201	0.055	Q5VWT5.pdb.gz	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14BB9	9.89e-94	273	191	0.734	0.764	MA6D1_MOUSE MAP6 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Map6d1 PE=1 SV=1
2	Q7TSJ2	3.90e-12	66.6	906	0.131	0.029	MAP6_MOUSE Microtubule-associated protein 6 OS=Mus musculus OX=10090 GN=Map6 PE=1 SV=2
3	Q96JE9	1.03e-11	65.1	813	0.116	0.028	MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens OX=9606 GN=MAP6 PE=1 SV=2
4	Q63560	1.07e-11	65.1	952	0.116	0.024	MAP6_RAT Microtubule-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Map6 PE=1 SV=1
5	Q57UC3	0.50	33.5	796	0.111	0.028	Q57UC3_TRYB2 Ubiquitin-activating enzyme E1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.70 PE=4 SV=1
6	O75962	0.85	32.7	3097	0.085	0.005	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
7	Q9P2K8	2.8	31.2	1649	0.101	0.012	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
8	A0A0G2K475	3.6	30.8	1166	0.126	0.021	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
9	Q96PV4	4.9	30.4	448	0.090	0.040	PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens OX=9606 GN=PNMA5 PE=1 SV=2
10	Q6P122	6.4	30.0	856	0.065	0.015	Q6P122_DANRE dynamin GTPase OS=Danio rerio OX=7955 GN=dnm2l PE=1 SV=1
11	C6KSK8	8.5	29.6	2879	0.065	0.005	C6KSK8_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0600200 PE=4 SV=1
12	Q5EXX3	9.5	29.6	1203	0.090	0.015	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09377 SBDS_domain_II	2.7e+02	13.1	SBDS protein, domain II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314560

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325421	0.638	Presenilins-associated rhomboid-like protein, mitochondrial
2	9606.ENSP00000398688	0.607	Von Willebrand factor A domain containing 5B2
3	9606.ENSP00000279441	0.593	Stromelysin-2
4	9606.ENSP00000306983	0.521	YEATS domain-containing protein 2
5	9606.ENSP00000353732	0.521	CAP-Gly domain-containing linker protein 3
6	9606.ENSP00000369907	0.508	Stabilizer of axonemal microtubules 1
7	9606.ENSP00000359049	0.506	Small RNA 2'-O-methyltransferase
8	9606.ENSP00000373360	0.506	Protein FAM131A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0005516	0.998	calmodulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0050789	0.990	regulation of biological process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0009987	0.988	cellular process
GO:0043170	0.985	macromolecule metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0019538	0.984	protein metabolic process
GO:0043412	0.982	macromolecule modification
GO:0018193	0.972	peptidyl-amino acid modification
GO:0044237	0.971	cellular metabolic process
GO:0010639	0.968	negative regulation of organelle organization
GO:0051494	0.957	negative regulation of cytoskeleton organization
GO:0043244	0.922	regulation of protein-containing complex disassembly
GO:0044260	0.904	cellular macromolecule metabolic process
GO:1902904	0.900	negative regulation of supramolecular fiber organization
GO:0043543	0.889	protein acylation
GO:0034645	0.883	cellular macromolecule biosynthetic process
GO:0070507	0.861	regulation of microtubule cytoskeleton organization
GO:1901566	0.836	organonitrogen compound biosynthetic process
GO:0031110	0.829	regulation of microtubule polymerization or depolymerization
GO:0042158	0.829	lipoprotein biosynthetic process
GO:1901879	0.823	regulation of protein depolymerization
GO:0006497	0.817	protein lipidation
GO:1901880	0.811	negative regulation of protein depolymerization
GO:0018198	0.808	peptidyl-cysteine modification
GO:0031111	0.797	negative regulation of microtubule polymerization or depolymerization
GO:0031365	0.783	N-terminal protein amino acid modification
GO:0007026	0.740	negative regulation of microtubule depolymerization
GO:0018345	0.535	protein palmitoylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005794	0.994	Golgi apparatus
GO:0005798	0.986	Golgi-associated vesicle
GO:0005801	0.979	cis-Golgi network
GO:0043232	0.791	intracellular non-membrane-bounded organelle
GO:0005856	0.578	cytoskeleton
GO:0015630	0.546	microtubule cytoskeleton
GO:0005634	0.402	nucleus
GO:0099080	0.383	supramolecular complex
GO:0071944	0.349	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]