StarFunc result for job id Q9H9J2

User Input

>input (332 residues)
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR
SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK
SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL
SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL
LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA
LRKLYGFTENRRPWNYSKPKETLRAEKSITAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1MA90	0.904	0.904	2.927E-55	332	1.000	1.000	A1MA90.pdb.gz
2	AFDB:Q2KIS2	0.904	0.904	4.703E-51	332	0.880	0.880	Q2KIS2.pdb.gz	RM44_BOVIN Large ribosomal subunit protein mL44 OS=Bos taurus OX=9913 GN=MRPL44 PE=2 SV=1
3	AFDB:Q9CY73	0.918	0.915	5.724E-50	333	0.858	0.856	Q9CY73.pdb.gz	RM44_MOUSE Large ribosomal subunit protein mL44 OS=Mus musculus OX=10090 GN=Mrpl44 PE=1 SV=3
4	PDB:7l08c	0.858	0.984	9.521E-44	289	0.870	1.000	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
5	AFDB:Q7K141	0.798	0.793	2.137E-28	334	0.313	0.311	Q7K141.pdb.gz	Q7K141_DROME Large ribosomal subunit protein mL44 (Fragment) OS=Drosophila melanogaster OX=7227 GN=mRpL44 PE=2 SV=1
6	AFDB:O43042	0.587	0.597	7.403E-14	326	0.148	0.150	O43042.pdb.gz	RM03_SCHPO Large ribosomal subunit protein mL44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrpl3 PE=3 SV=1
7	AFDB:P36516	0.560	0.485	1.383E-13	390	0.178	0.151	P36516.pdb.gz	RM03_YEAST Large ribosomal subunit protein mL44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRPL3 PE=1 SV=2
8	PDB:3j6b5	0.555	0.564	1.060E-12	326	0.160	0.163	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
9	AFDB:P0A7Y0	0.382	0.547	1.945E-11	226	0.130	0.190	P0A7Y0.pdb.gz	RNC_ECOLI Ribonuclease 3 OS=Escherichia coli (strain K12) OX=83333 GN=rnc PE=1 SV=1
10	AFDB:Q9LTQ0	0.406	0.350	1.945E-11	391	0.166	0.141	Q9LTQ0.pdb.gz	RTL2_ARATH Ribonuclease 3-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=RTL2 PE=1 SV=1
11	PDB:7r97A	0.396	0.569	5.840E-11	226	0.123	0.181	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
12	AFDB:O67082	0.359	0.517	1.923E-10	221	0.133	0.199	O67082.pdb.gz	RNC_AQUAE Ribonuclease 3 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=rnc PE=1 SV=1
13	PDB:1yykA	0.386	0.560	3.613E-10	221	0.133	0.199	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
14	AFDB:O01326	0.415	0.141	4.422E-10	1086	0.163	0.050	O01326.pdb.gz	RNC_CAEEL Ribonuclease 3 OS=Caenorhabditis elegans OX=6239 GN=drsh-1 PE=2 SV=2
15	PDB:7yz4A	0.393	0.116	1.967E-7	1234	0.127	0.034	7yz4A.pdb.gz
16	PDB:7vg3A	0.357	0.148	5.804E-6	860	0.157	0.060	7vg3A.pdb.gz	Mechanism of siRNA production by a plant Dicer-RNA complex in dicing-competent conformation.
17	PDB:7yymA	0.346	0.107	6.785E-6	1281	0.120	0.031	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
18	PDB:7v6cA	0.383	0.090	1.406E-5	1540	0.139	0.030	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
19	PDB:8dgaA	0.368	0.083	1.732E-5	1629	0.123	0.025	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
20	PDB:8dfvA	0.364	0.080	6.043E-5	1664	0.130	0.026	8dfvA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2KIS2	0.0	605	332	0.880	0.880	RM44_BOVIN Large ribosomal subunit protein mL44 OS=Bos taurus OX=9913 GN=MRPL44 PE=2 SV=1
2	Q9CY73	0.0	582	333	0.858	0.856	RM44_MOUSE Large ribosomal subunit protein mL44 OS=Mus musculus OX=10090 GN=Mrpl44 PE=1 SV=3
3	Q9H9J2	0.0	679	332	1.000	1.000	RM44_HUMAN Large ribosomal subunit protein mL44 OS=Homo sapiens OX=9606 GN=MRPL44 PE=1 SV=1
4	Q9VNC1	2.27e-53	179	321	0.289	0.299	Q9VNC1_DROME Large ribosomal subunit protein mL44 OS=Drosophila melanogaster OX=7227 GN=mRpL44 PE=1 SV=1
5	Q7K141	2.98e-53	179	334	0.289	0.287	Q7K141_DROME Large ribosomal subunit protein mL44 (Fragment) OS=Drosophila melanogaster OX=7227 GN=mRpL44 PE=2 SV=1
6	O43042	1.20e-06	52.0	326	0.139	0.141	RM03_SCHPO Large ribosomal subunit protein mL44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrpl3 PE=3 SV=1
7	P36516	8.44e-05	46.2	390	0.136	0.115	RM03_YEAST Large ribosomal subunit protein mL44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRPL3 PE=1 SV=2
8	Q9NRR4	0.80	34.3	1374	0.142	0.034	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2
9	Q5HZJ0	0.81	34.3	1373	0.142	0.034	RNC_MOUSE Ribonuclease 3 OS=Mus musculus OX=10090 GN=Drosha PE=1 SV=1
10	A2RV16	0.87	33.9	1289	0.142	0.036	A2RV16_DANRE Ribonuclease 3 OS=Danio rerio OX=7955 GN=zgc:158612 PE=1 SV=1
11	Q38CX9	1.5	33.1	1378	0.051	0.012	Q38CX9_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2660 PE=4 SV=1
12	Q1MTE3	2.0	33.1	1568	0.069	0.015	Q1MTE3_DANRE Probable global transcription activator SNF2L2 OS=Danio rerio OX=7955 GN=psa-4 PE=1 SV=1
13	Q86XI2	2.9	32.3	1143	0.045	0.013	CNDG2_HUMAN Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
14	A7E2E1	4.4	32.0	1647	0.057	0.012	A7E2E1_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=2 SV=1
15	P51532	4.4	32.0	1647	0.057	0.012	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
16	Q9HBD4	4.8	31.6	1679	0.057	0.011	Q9HBD4_HUMAN SMARCA4 isoform 2 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
17	A0A2R8YGG3	6.6	31.2	1455	0.057	0.013	A0A2R8YGG3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
18	A0A2R8Y6V2	7.6	31.2	1041	0.057	0.018	A0A2R8Y6V2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
19	P08037	8.7	30.4	402	0.075	0.062	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
20	A0A2R8Y526	8.9	30.8	1068	0.057	0.018	A0A2R8Y526_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00035 dsrm	9.5	18.3	Double-stranded RNA binding motif
2	PF00636 Ribonuclease_3	89	15.1	Ribonuclease III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339844	0.999	Mitochondrial ribosomal protein L43
2	9606.ENSP00000377486	0.999	Mitochondrial ribosomal protein L19
3	9606.ENSP00000417602	0.999	Belongs to the universal ribosomal protein uL29 family.
4	9606.ENSP00000223324	0.998	Mitochondrial ribosomal protein L32
5	9606.ENSP00000253099	0.998	Mitochondrial ribosomal protein L4
6	9606.ENSP00000260102	0.998	Mitochondrial ribosomal protein L15
7	9606.ENSP00000300151	0.998	Mitochondrial ribosomal protein L16
8	9606.ENSP00000305682	0.998	Mitochondrial ribosomal protein L39
9	9606.ENSP00000306548	0.998	Mitochondrial ribosomal protein L13
10	9606.ENSP00000312311	0.998	Mitochondrial ribosomal protein L46
11	9606.ENSP00000360498	0.998	39S ribosomal protein L41, mitochondrial
12	9606.ENSP00000225969	0.997	Mitochondrial ribosomal protein L27
13	9606.ENSP00000279242	0.997	Mitochondrial ribosomal protein L49
14	9606.ENSP00000288937	0.997	Mitochondrial ribosomal protein L17
15	9606.ENSP00000308275	0.997	Mitochondrial ribosomal protein L38
16	9606.ENSP00000264995	0.996	Mitochondrial ribosomal protein L3
17	9606.ENSP00000308897	0.996	Mitochondrial ribosomal protein L11
18	9606.ENSP00000363999	0.996	Mitochondrial ribosomal protein L50
19	9606.ENSP00000199706	0.995	Mitochondrial ribosomal protein L28
20	9606.ENSP00000333401	0.995	Mitochondrial ribosomal protein L40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.996	RNA binding
GO:0003824	0.372	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006414	0.989	translational elongation
GO:0140053	0.927	mitochondrial gene expression
GO:0032543	0.874	mitochondrial translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0031090	0.997	organelle membrane
GO:0005654	0.996	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0005743	0.987	mitochondrial inner membrane
GO:0044391	0.971	ribosomal subunit
GO:0005759	0.969	mitochondrial matrix
GO:0005761	0.954	mitochondrial ribosome
GO:0015934	0.943	large ribosomal subunit
GO:0098798	0.920	mitochondrial protein-containing complex
GO:0005762	0.909	mitochondrial large ribosomal subunit
GO:0071944	0.888	cell periphery
GO:0005886	0.864	plasma membrane
GO:0016604	0.821	nuclear body
GO:0005829	0.307	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]