StarFunc result for job id Q9H9L7

User Input

>input (192 residues)
MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQ
PAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSP
GSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIM
RRYGTRPTSYVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9L7	0.999	0.999	1.103E-29	192	1.000	1.000	Q9H9L7.pdb.gz	AKIR1_HUMAN Akirin-1 OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
2	AFDB:A0A287BDC1	0.312	0.296	1.986E-14	203	0.583	0.552	A0A287BDC1.pdb.gz	AKIR2_PIG Akirin-2 OS=Sus scrofa OX=9823 GN=AKIRIN2 PE=2 SV=2
3	AFDB:Q6GQB5	0.341	0.360	6.451E-12	181	0.536	0.569	Q6GQB5.pdb.gz	AKIR2_XENLA Akirin-2 OS=Xenopus laevis OX=8355 GN=akirin2.S PE=1 SV=1
4	AFDB:Q9VS59	0.372	0.356	4.278E-9	201	0.370	0.353	Q9VS59.pdb.gz	AKIRN_DROME Akirin OS=Drosophila melanogaster OX=7227 GN=akirin PE=1 SV=1
5	PDB:7nhtc	0.195	0.692	7.114E-2	48	0.193	0.771	7nhtc.pdb.gz
6	AFDB:O17838	0.177	0.055	1.102E-1	752	0.130	0.033	O17838.pdb.gz	O17838_CAEEL Claspin OS=Caenorhabditis elegans OX=6239 GN=clsp-1 PE=1 SV=2
7	AFDB:F1QAL1	0.284	0.085	1.365E-1	677	0.151	0.043	F1QAL1.pdb.gz	F1QAL1_DANRE NEDD1 gamma-tubulin ring complex targeting factor OS=Danio rerio OX=7955 GN=fb78g03 PE=1 SV=3
8	AFDB:C0H4I0	0.187	0.125	1.574E-1	309	0.130	0.081	C0H4I0.pdb.gz	C0H4I0_PLAF7 Exported protein family 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0601000 PE=4 SV=1
9	AFDB:Q9JJC9	0.256	0.147	1.691E-1	404	0.161	0.077	Q9JJC9.pdb.gz	HERP2_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Mus musculus OX=10090 GN=Herpud2 PE=2 SV=1
10	AFDB:O42927	0.172	0.163	2.250E-1	207	0.188	0.174	O42927.pdb.gz	YBD3_SCHPO Uncharacterized protein C16C6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16C6.03c PE=4 SV=4
11	AFDB:D2J0Y4	0.201	0.074	2.595E-1	644	0.141	0.042	D2J0Y4.pdb.gz	CJ090_MOUSE (E2-independent) E3 ubiquitin-conjugating enzyme FATS OS=Mus musculus OX=10090 GN=D7Ertd443e PE=1 SV=1
12	PDB:6yxxE8	0.134	0.166	6.391	154	0.073	0.091	6yxxE8.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:6id0L	0.141	0.085	7.917	475	0.130	0.053	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:7v2wJ	0.150	0.127	7.917	236	0.115	0.093	7v2wJ.pdb.gz
15	PDB:4v6wCD	0.148	0.104	9.132	290	0.042	0.028	4v6wCD.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:5wlcST	0.171	0.073	9.808	599	0.135	0.043	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
17	PDB:7myjC	0.118	0.061	9.808	465	0.047	0.019	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H9L7	4.07e-141	392	192	1.000	1.000	AKIR1_HUMAN Akirin-1 OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
2	Q99LF1	1.82e-129	363	191	0.927	0.932	AKIR1_MOUSE Akirin-1 OS=Mus musculus OX=10090 GN=Akirin1 PE=1 SV=1
3	H0YEQ5	1.21e-88	258	130	0.656	0.969	H0YEQ5_HUMAN Akirin 1 (Fragment) OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
4	Q6GQB5	6.64e-59	184	181	0.557	0.591	AKIR2_XENLA Akirin-2 OS=Xenopus laevis OX=8355 GN=akirin2.S PE=1 SV=1
5	Q53H80	2.24e-58	183	203	0.594	0.562	AKIR2_HUMAN Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2
6	A0A287BDC1	3.44e-56	178	203	0.594	0.562	AKIR2_PIG Akirin-2 OS=Sus scrofa OX=9823 GN=AKIRIN2 PE=2 SV=2
7	Q25C79	4.69e-54	172	201	0.583	0.557	AKIR2_RAT Akirin-2 OS=Rattus norvegicus OX=10116 GN=Akirin2 PE=1 SV=1
8	B1AXD8	6.51e-54	172	201	0.583	0.557	AKIR2_MOUSE Akirin-2 OS=Mus musculus OX=10090 GN=Akirin2 PE=1 SV=1
9	Q9VS59	1.68e-27	104	201	0.396	0.378	AKIRN_DROME Akirin OS=Drosophila melanogaster OX=7227 GN=akirin PE=1 SV=1
10	Q966L3	4.46e-10	58.9	218	0.323	0.284	AKIRN_CAEEL Akirin OS=Caenorhabditis elegans OX=6239 GN=akir-1 PE=1 SV=1
11	R4GNE1	3.5	29.3	91	0.078	0.165	R4GNE1_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=1
12	Q4U4S6	4.7	30.4	3784	0.115	0.006	XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Xirp2 PE=1 SV=1
13	Q8C5S7	4.7	30.4	591	0.068	0.022	REC8_MOUSE Meiotic recombination protein REC8 homolog OS=Mus musculus OX=10090 GN=Rec8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257787	0.702	Akirin-2
2	9606.ENSP00000358549	0.656	Probable arginine--tRNA ligase, mitochondrial
3	9606.ENSP00000358497	0.646	mRNA-capping enzyme
4	9606.ENSP00000358590	0.623	Zinc finger protein 292
5	9606.ENSP00000412673	0.615	Gamma-aminobutyric acid receptor subunit rho-1
6	9606.ENSP00000365919	0.611	WD repeat-containing protein 13
7	9606.ENSP00000362136	0.594	Glycoprotein endo-alpha-1,2-mannosidase-like protein
8	9606.ENSP00000435355	0.587	Gap junction beta-7 protein
9	9606.ENSP00000262188	0.570	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000392617	0.565	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	9606.ENSP00000378414	0.556	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
12	9606.ENSP00000257789	0.549	Origin recognition complex subunit 3
13	9606.ENSP00000289248	0.542	Rhomboid-related protein 2
14	9606.ENSP00000351669	0.536	Glycoprotein endo-alpha-1,2-mannosidase
15	9606.ENSP00000334840	0.527	Proline-rich nuclear receptor coactivator 2
16	9606.ENSP00000363745	0.527	Heterogeneous nuclear ribonucleoprotein R
17	9606.ENSP00000345055	0.520	Potassium voltage-gated channel subfamily KQT member 5
18	9606.ENSP00000421544	0.517	Pterin-4-alpha-carbinolamine dehydratase 2
19	9606.ENSP00000260950	0.514	Growth/differentiation factor 8
20	9606.ENSP00000446215	0.510	GTP-binding nuclear protein Ran

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0048522	0.936	positive regulation of cellular process
GO:0010468	0.891	regulation of gene expression
GO:0048583	0.795	regulation of response to stimulus
GO:0009889	0.780	regulation of biosynthetic process
GO:0019219	0.745	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.648	regulation of RNA metabolic process
GO:0031326	0.643	regulation of cellular biosynthetic process
GO:0010556	0.641	regulation of macromolecule biosynthetic process
GO:0032101	0.609	regulation of response to external stimulus
GO:0071704	0.600	organic substance metabolic process
GO:0044238	0.574	primary metabolic process
GO:0006355	0.559	regulation of DNA-templated transcription
GO:0044237	0.545	cellular metabolic process
GO:0006807	0.544	nitrogen compound metabolic process
GO:0045595	0.527	regulation of cell differentiation
GO:0002682	0.525	regulation of immune system process
GO:0043170	0.474	macromolecule metabolic process
GO:0009893	0.447	positive regulation of metabolic process
GO:0048519	0.445	negative regulation of biological process
GO:0010604	0.432	positive regulation of macromolecule metabolic process
GO:0051173	0.421	positive regulation of nitrogen compound metabolic process
GO:0042127	0.417	regulation of cell population proliferation
GO:0006357	0.388	regulation of transcription by RNA polymerase II
GO:0032502	0.383	developmental process
GO:0048856	0.349	anatomical structure development
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0010557	0.301	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.998	membrane
GO:0012505	0.936	endomembrane system
GO:0031090	0.858	organelle membrane
GO:0031967	0.837	organelle envelope
GO:0005635	0.825	nuclear envelope
GO:0031965	0.809	nuclear membrane
GO:0032991	0.704	protein-containing complex
GO:0005737	0.701	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]