StarFunc result for job id Q9H9P8

User Input

>input (463 residues)
MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCR
GLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPI
VIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKL
ASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV
FDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9P8	1.000	1.000	1.857E-95	463	1.000	1.000	Q9H9P8.pdb.gz	L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=L2HGDH PE=1 SV=3
2	AFDB:Q91YP0	0.966	0.964	1.484E-84	464	0.825	0.823	Q91YP0.pdb.gz	L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=L2hgdh PE=1 SV=1
3	AFDB:P37339	0.837	0.917	8.254E-51	422	0.374	0.410	P37339.pdb.gz	LHGD_ECOLI L-2-hydroxyglutarate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=lhgD PE=1 SV=3
4	AFDB:Q38A39	0.838	0.749	1.380E-44	520	0.326	0.290	Q38A39.pdb.gz	Q38A39_TRYB2 FAD dependent oxidoreductase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1040 PE=4 SV=1
5	AFDB:Q9LES4	0.688	0.660	8.145E-33	483	0.253	0.242	Q9LES4.pdb.gz	L2HDH_ARATH L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=L2HGDH PE=1 SV=1
6	AFDB:P33940	0.684	0.588	2.457E-23	548	0.175	0.148	P33940.pdb.gz	MQO_ECOLI Malate:quinone oxidoreductase OS=Escherichia coli (strain K12) OX=83333 GN=mqo PE=1 SV=2
7	AFDB:P9WJP5	0.692	0.653	7.462E-23	493	0.194	0.183	P9WJP5.pdb.gz	MQO_MYCTU Probable malate:quinone oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mqo PE=1 SV=1
8	AFDB:Q9HVF1	0.714	0.657	1.375E-22	507	0.186	0.170	Q9HVF1.pdb.gz	MQO2_PSEAE Probable malate:quinone oxidoreductase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mqo2 PE=3 SV=1
9	AFDB:Q5JFG7	0.629	0.743	3.343E-22	386	0.171	0.205	Q5JFG7.pdb.gz	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
10	PDB:4yshA	0.624	0.768	4.298E-21	370	0.164	0.205	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
11	AFDB:P0A9C0	0.656	0.567	1.169E-20	542	0.173	0.148	P0A9C0.pdb.gz	GLPA_ECOLI Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Escherichia coli (strain K12) OX=83333 GN=glpA PE=1 SV=1
12	PDB:3if9A	0.623	0.780	1.204E-19	364	0.143	0.181	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
13	PDB:3nycA	0.625	0.749	4.085E-19	381	0.153	0.186	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
14	PDB:2uzzB	0.602	0.735	1.209E-17	372	0.138	0.172	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
15	PDB:4pabB	0.581	0.342	3.883E-17	824	0.125	0.070	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
16	PDB:3awiD	0.569	0.413	2.725E-14	659	0.121	0.085	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
17	PDB:2qcuB	0.592	0.552	3.403E-14	501	0.138	0.128	2qcuB.pdb.gz	Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism.
18	PDB:5ez7A	0.510	0.629	3.919E-13	363	0.156	0.198	5ez7A.pdb.gz	Crystal structure of the flavoenzyme PA4991 from Pseudomonas aeruginosa.
19	PDB:2du8A	0.520	0.683	4.401E-11	340	0.123	0.168	2du8A.pdb.gz	Crystal structure of human D-amino acid oxidase: Context-dependent variability of the backbone conformation of the VAAGL hydrophobic stretch located at the si-face of the flavin ring
20	PDB:5oc2A	0.568	0.593	4.401E-11	441	0.127	0.134	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JVN9	0.0	799	441	0.873	0.916	C9JVN9_HUMAN L-2-hydroxyglutarate dehydrogenase OS=Homo sapiens OX=9606 GN=L2HGDH PE=1 SV=1
2	Q91YP0	0.0	743	464	0.819	0.817	L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=L2hgdh PE=1 SV=1
3	Q9H9P8	0.0	945	463	1.000	1.000	L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=L2HGDH PE=1 SV=3
4	P37339	1.11e-105	322	422	0.374	0.410	LHGD_ECOLI L-2-hydroxyglutarate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=lhgD PE=1 SV=3
5	Q38A39	3.01e-62	212	520	0.317	0.283	Q38A39_TRYB2 FAD dependent oxidoreductase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1040 PE=4 SV=1
6	Q9LES4	7.73e-39	149	483	0.279	0.267	L2HDH_ARATH L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=L2HGDH PE=1 SV=1
7	Q72AQ2	6.41e-05	47.8	516	0.143	0.128	Q72AQ2_DESVH Anaerobic glycerol-3-phosphate dehydrogenase, A subunit, putative OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1940 PE=1 SV=1
8	Q9UL11	1.72e-04	45.8	328	0.127	0.180	Q9UL11_HUMAN Uncharacterized protein SARDH (Fragment) OS=Homo sapiens OX=9606 GN=SARDH PE=2 SV=1
9	Q9UL12	1.85e-04	46.6	918	0.127	0.064	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
10	O96023	1.92e-04	46.2	475	0.127	0.124	O96023_HUMAN Dimethylglycine dehydrogenase-like protein isoform 2 OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q9UL10	3.04e-04	45.4	396	0.125	0.146	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
12	Q8NCN5	0.002	43.1	879	0.153	0.081	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
13	Q99LB7	0.002	42.7	919	0.108	0.054	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
14	Q64380	0.003	42.7	919	0.110	0.055	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
15	P0A9C0	0.036	38.9	542	0.104	0.089	GLPA_ECOLI Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Escherichia coli (strain K12) OX=83333 GN=glpA PE=1 SV=1
16	Q7TSQ8	0.10	37.7	878	0.127	0.067	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
17	P37906	0.20	36.6	426	0.104	0.113	PUUB_ECOLI Gamma-glutamylputrescine oxidoreductase OS=Escherichia coli (strain K12) OX=83333 GN=puuB PE=1 SV=2
18	P9WJP5	0.20	36.6	493	0.231	0.217	MQO_MYCTU Probable malate:quinone oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mqo PE=1 SV=1
19	O53762	0.26	36.2	486	0.035	0.033	O53762_MYCTU Probable monooxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0565c PE=1 SV=1
20	A1ZAZ2	0.30	36.2	894	0.099	0.051	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	2.9e-65	232.8	FAD dependent oxidoreductase
2	PF01494 FAD_binding_3	13	16.5	FAD binding domain
3	PF05834 Lycopene_cycl	2.9e+02	11.9	Lycopene cyclase protein
4	PF06039 Mqo	22	15.0	Malate:quinone oxidoreductase (Mqo)
5	PF13450 NAD_binding_8	45	15.7	NAD(P)-binding Rossmann-like domain
6	PF13454 NAD_binding_9	6.2e+02	11.8	FAD-NAD(P)-binding
7	PF07992 Pyr_redox_2	4.1	18.1	Pyridine nucleotide-disulphide oxidoreductase
8	PF01946 Thi4	17	16.1	Thi4 family
9	PF04820 Trp_halogenase	5.6e+02	10.8	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315351	0.944	D-2-hydroxyglutarate dehydrogenase, mitochondrial
2	9606.ENSP00000364490	0.849	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
3	9606.ENSP00000277865	0.829	Glutamate dehydrogenase 1, mitochondrial
4	9606.ENSP00000317379	0.819	Glutaminase kidney isoform, mitochondrial
5	9606.ENSP00000310447	0.818	Glutaminase liver isoform, mitochondrial
6	9606.ENSP00000307900	0.813	Glutamine synthetase
7	9606.ENSP00000327589	0.813	Glutamate dehydrogenase 2, mitochondrial
8	9606.ENSP00000350928	0.800	Glutamate decarboxylase 1
9	9606.ENSP00000365437	0.800	Glutamate decarboxylase 2
10	9606.ENSP00000331897	0.744	Isocitrate dehydrogenase [NADP], mitochondrial
11	9606.ENSP00000390265	0.730	Isocitrate dehydrogenase 1, cytosolic
12	9606.ENSP00000327070	0.692	Malate dehydrogenase, mitochondrial
13	9606.ENSP00000355518	0.680	Fumarate hydratase, mitochondrial
14	9606.ENSP00000269097	0.600	Glucose-6-phosphatase 3
15	9606.ENSP00000438144	0.587	Malate dehydrogenase, cytoplasmic
16	9606.ENSP00000297994	0.578	tRNA methyltransferase 10 homolog B
17	9606.ENSP00000445175	0.562	Lactate dehydrogenase A
18	9606.ENSP00000379865	0.556	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
19	9606.ENSP00000222673	0.534	2-oxoglutarate dehydrogenase, mitochondrial
20	9606.ENSP00000264932	0.521	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016614	1.000	oxidoreductase activity, acting on CH-OH group of donors
GO:0005488	0.991	binding
GO:0047545	0.975	2-hydroxyglutarate dehydrogenase activity
GO:0005515	0.782	protein binding
GO:1901363	0.646	heterocyclic compound binding
GO:0097159	0.646	organic cyclic compound binding
GO:0043167	0.643	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0043648	0.994	dicarboxylic acid metabolic process
GO:0044238	0.661	primary metabolic process
GO:0006807	0.494	nitrogen compound metabolic process
GO:1901564	0.367	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.973	membrane
GO:0031090	0.941	organelle membrane
GO:0031967	0.871	organelle envelope
GO:0005740	0.851	mitochondrial envelope
GO:0031966	0.841	mitochondrial membrane
GO:0019866	0.779	organelle inner membrane
GO:0070013	0.742	intracellular organelle lumen
GO:0005743	0.737	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	1.000	Acting on the CH-OH group of donors.
RHEA:21252	0.975	(S)-2-hydroxyglutarate + A = 2-oxoglutarate + AH2
EC:1.1.99.2	0.975	L-2-hydroxyglutarate dehydrogenase.

[back to server]