StarFunc result for job id Q9H9S0

User Input

>input (305 residues)
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NSW7	0.473	0.473	2.314E-41	305	0.990	0.990	Q6NSW7.pdb.gz	NANP8_HUMAN Homeobox protein NANOGP8 OS=Homo sapiens OX=9606 GN=NANOGP8 PE=2 SV=2
2	AFDB:D3ZS29	0.248	0.243	2.126E-24	312	0.613	0.599	D3ZS29.pdb.gz	D3ZS29_RAT Nanog homeobox OS=Rattus norvegicus OX=10116 GN=Nanog PE=4 SV=1
3	AFDB:Q80Z64	0.273	0.273	1.071E-22	305	0.580	0.580	Q80Z64.pdb.gz	NANOG_MOUSE Homeobox protein NANOG OS=Mus musculus OX=10090 GN=Nanog PE=1 SV=1
4	AFDB:A7Y7W3	0.219	0.216	6.654E-10	309	0.279	0.275	A7Y7W3.pdb.gz	NANOG_CHICK Homeobox protein NANOG OS=Gallus gallus OX=9031 GN=NANOG PE=1 SV=2
5	AFDB:O95231	0.218	0.255	1.086E-7	258	0.230	0.271	O95231.pdb.gz	VENTX_HUMAN Homeobox protein VENTX OS=Homo sapiens OX=9606 GN=VENTX PE=1 SV=1
6	AFDB:A6NCS4	0.212	0.215	4.009E-7	301	0.177	0.179	A6NCS4.pdb.gz	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
7	AFDB:O42173	0.218	0.234	5.558E-7	282	0.190	0.206	O42173.pdb.gz	PV1_XENLA Homeobox protein pv.1 OS=Xenopus laevis OX=8355 GN=pv.1 PE=1 SV=1
8	AFDB:Q6AXL1	0.241	0.271	1.140E-6	269	0.164	0.186	Q6AXL1.pdb.gz
9	AFDB:Q6DGH9	0.225	0.218	1.387E-6	315	0.157	0.152	Q6DGH9.pdb.gz	OTBP_DANRE Homeobox protein orthopedia B OS=Danio rerio OX=7955 GN=otpb PE=1 SV=1
10	AFDB:Q9YH71	0.207	0.232	1.687E-6	270	0.216	0.244	Q9YH71.pdb.gz	VNT1B_XENLA Homeobox protein vent1B OS=Xenopus laevis OX=8355 GN=vent1B PE=2 SV=1
11	PDB:4egcA	0.157	0.089	2.042E-2	539	0.043	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.152	0.538	8.592E-2	73	0.039	0.164	2hi3A.pdb.gz
13	PDB:5nr5A	0.145	0.343	6.097E-1	113	0.062	0.168	5nr5A.pdb.gz
14	PDB:7fbyA	0.106	0.194	7.417E-1	153	0.036	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5z56L	0.145	0.131	8.452E-1	342	0.033	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:7b93E	0.107	0.147	1.098	215	0.023	0.033	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:2vbwA	0.094	0.181	1.624	147	0.046	0.095	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
18	PDB:5aj0BZ	0.137	0.418	1.734	86	0.043	0.151	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:7f0rF	0.089	0.096	1.734	278	0.039	0.043	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
20	PDB:7dcoL	0.125	0.090	2.924	435	0.052	0.037	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SG05	0.0	575	289	0.938	0.990	A0A0D9SG05_HUMAN Nanog homeobox retrogene P8 OS=Homo sapiens OX=9606 GN=NANOGP8 PE=1 SV=1
2	Q6NSW7	0.0	618	305	0.990	0.990	NANP8_HUMAN Homeobox protein NANOGP8 OS=Homo sapiens OX=9606 GN=NANOGP8 PE=2 SV=2
3	Q9H9S0	0.0	624	305	1.000	1.000	NANOG_HUMAN Homeobox protein NANOG OS=Homo sapiens OX=9606 GN=NANOG PE=1 SV=2
4	D3ZS29	1.03e-115	338	312	0.620	0.606	D3ZS29_RAT Nanog homeobox OS=Rattus norvegicus OX=10116 GN=Nanog PE=4 SV=1
5	A8QWW8	4.79e-108	318	311	0.587	0.576	A8QWW8_RAT Nanog OS=Rattus norvegicus OX=10116 GN=Nanog PE=2 SV=1
6	Q80Z64	2.60e-103	306	305	0.580	0.580	NANOG_MOUSE Homeobox protein NANOG OS=Mus musculus OX=10090 GN=Nanog PE=1 SV=1
7	A7Y7W3	4.93e-24	101	309	0.216	0.214	NANOG_CHICK Homeobox protein NANOG OS=Gallus gallus OX=9031 GN=NANOG PE=1 SV=2
8	Q810B3	4.94e-15	75.1	232	0.121	0.159	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
9	Q3C1V8	2.59e-14	73.2	233	0.115	0.150	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
10	P70396	3.20e-14	73.6	289	0.121	0.128	DLX5_MOUSE Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1
11	P50575	3.33e-14	73.6	289	0.121	0.128	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
12	A5JNG8	9.49e-14	73.2	384	0.105	0.083	A5JNG8_DANRE Nanog OS=Danio rerio OX=7955 GN=fd20a07 PE=2 SV=1
13	P56178	2.54e-13	71.2	289	0.118	0.125	DLX5_HUMAN Homeobox protein DLX-5 OS=Homo sapiens OX=9606 GN=DLX5 PE=1 SV=2
14	P22808	2.72e-13	72.4	723	0.115	0.048	VND_DROME Homeobox protein vnd OS=Drosophila melanogaster OX=7227 GN=vnd PE=1 SV=3
15	P50576	3.48e-13	70.5	283	0.125	0.134	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
16	O60479	3.99e-13	70.5	287	0.125	0.132	DLX3_HUMAN Homeobox protein DLX-3 OS=Homo sapiens OX=9606 GN=DLX3 PE=1 SV=1
17	Q64205	3.99e-13	70.5	287	0.125	0.132	DLX3_MOUSE Homeobox protein DLX-3 OS=Mus musculus OX=10090 GN=Dlx3 PE=1 SV=1
18	Q04787	4.29e-13	71.2	429	0.105	0.075	BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster OX=7227 GN=bsh PE=2 SV=5
19	Q5BJA8	1.50e-12	68.2	237	0.125	0.160	Q5BJA8_DANRE Homeobox protein Nkx-2.2 OS=Danio rerio OX=7955 GN=nkx2.2b PE=2 SV=1
20	Q24255	1.55e-12	70.1	544	0.108	0.061	BARH1_DROME Homeobox protein B-H1 OS=Drosophila melanogaster OX=7227 GN=B-H1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.7e-15	67.9	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229307

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217086	0.999	Sal-like protein 4
2	9606.ENSP00000259915	0.999	POU domain, class 5, transcription factor 1
3	9606.ENSP00000264657	0.998	Signal transducer and activator of transcription 3
4	9606.ENSP00000323588	0.998	Transcription factor SOX-2
5	9606.ENSP00000251020	0.993	Sal-like protein 1
6	9606.ENSP00000363804	0.991	Krueppel-like factor 4
7	9606.ENSP00000362748	0.989	Methylcytosine dioxygenase TET1
8	9606.ENSP00000398632	0.988	CD44 antigen
9	9606.ENSP00000479618	0.988	Myc proto-oncogene protein
10	9606.ENSP00000335306	0.987	Developmental pluripotency-associated protein 4
11	9606.ENSP00000363314	0.987	Protein lin-28 homolog A
12	9606.ENSP00000442788	0.987	Methylcytosine dioxygenase TET2
13	9606.ENSP00000419298	0.986	Putative POU domain, class 5, transcription factor 1B
14	9606.ENSP00000264498	0.981	Fibroblast growth factor 2
15	9606.ENSP00000296145	0.976	Teratocarcinoma-derived growth factor 1
16	9606.ENSP00000422488	0.973	Steroid hormone receptor ERR2
17	9606.ENSP00000287538	0.971	Zinc finger protein ZIC 3
18	9606.ENSP00000368253	0.971	Nuclear receptor subfamily 0 group B member 1
19	9606.ENSP00000425979	0.966	Ribonuclease 3
20	9606.ENSP00000276594	0.965	PR domain zinc finger protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.999	DNA-binding transcription factor activity
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0001067	0.998	transcription regulatory region nucleic acid binding
GO:0005515	0.997	protein binding
GO:0000977	0.988	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.950	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.558	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.987	positive regulation of cellular process
GO:0009987	0.986	cellular process
GO:0032502	0.976	developmental process
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.974	anatomical structure development
GO:0042127	0.969	regulation of cell population proliferation
GO:2001141	0.965	regulation of RNA biosynthetic process
GO:1903506	0.951	regulation of nucleic acid-templated transcription
GO:0010468	0.940	regulation of gene expression
GO:0030154	0.930	cell differentiation
GO:0006355	0.927	regulation of DNA-templated transcription
GO:0008284	0.907	positive regulation of cell population proliferation
GO:0009893	0.771	positive regulation of metabolic process
GO:0010604	0.730	positive regulation of macromolecule metabolic process
GO:0007275	0.724	multicellular organism development
GO:0051173	0.710	positive regulation of nitrogen compound metabolic process
GO:0006357	0.669	regulation of transcription by RNA polymerase II
GO:0050896	0.653	response to stimulus
GO:0048519	0.644	negative regulation of biological process
GO:0031325	0.613	positive regulation of cellular metabolic process
GO:0048523	0.582	negative regulation of cellular process
GO:0010557	0.461	positive regulation of macromolecule biosynthetic process
GO:0031328	0.461	positive regulation of cellular biosynthetic process
GO:0051254	0.458	positive regulation of RNA metabolic process
GO:0045893	0.451	positive regulation of DNA-templated transcription
GO:0051726	0.405	regulation of cell cycle
GO:0009892	0.401	negative regulation of metabolic process
GO:0051716	0.397	cellular response to stimulus
GO:0010605	0.390	negative regulation of macromolecule metabolic process
GO:0031324	0.360	negative regulation of cellular metabolic process
GO:0048731	0.348	system development
GO:0009653	0.333	anatomical structure morphogenesis
GO:0098727	0.325	maintenance of cell number
GO:0045944	0.325	positive regulation of transcription by RNA polymerase II
GO:0051172	0.316	negative regulation of nitrogen compound metabolic process
GO:0009890	0.301	negative regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.373	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]