StarFunc result for job id Q9H9S3

User Input

>input (476 residues)
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8STG9	0.991	0.991	1.263E-66	476	0.912	0.912	Q8STG9.pdb.gz	Q8STG9_DROME DSec61alpha OS=Drosophila melanogaster OX=7227 GN=Sec61alpha PE=1 SV=1
2	AFDB:P38377	0.995	0.995	4.853E-66	476	0.933	0.933	P38377.pdb.gz	S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris OX=9615 GN=SEC61A1 PE=1 SV=3
3	AFDB:O80774	0.977	0.979	2.180E-57	475	0.700	0.701	O80774.pdb.gz	O80774_ARATH AT2G34250 protein OS=Arabidopsis thaliana OX=3702 GN=At2g34250 PE=2 SV=1
4	AFDB:Q9ZV90	0.978	0.980	3.122E-57	475	0.693	0.695	Q9ZV90.pdb.gz	Q9ZV90_ARATH F9K20.24 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78720 PE=1 SV=1
5	AFDB:Q9P8E3	0.965	0.959	4.698E-51	479	0.580	0.576	Q9P8E3.pdb.gz	SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC61 PE=3 SV=2
6	AFDB:Q385E6	0.965	0.955	1.422E-49	481	0.548	0.543	Q385E6.pdb.gz	Q385E6_TRYB2 Pretranslocation protein, alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4100 PE=3 SV=1
7	AFDB:P32915	0.942	0.934	5.979E-49	480	0.548	0.544	P32915.pdb.gz	SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC61 PE=1 SV=1
8	AFDB:P79088	0.959	0.953	2.592E-47	479	0.565	0.562	P79088.pdb.gz	SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec61 PE=2 SV=1
9	PDB:6ftgx	0.818	0.908	1.139E-40	426	0.849	0.948	6ftgx.pdb.gz	Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
10	PDB:2wwbA	0.735	0.735	1.840E-39	476	0.916	0.916	2wwbA.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
11	PDB:7kahA	0.855	0.921	2.076E-38	441	0.534	0.576	7kahA.pdb.gz
12	AFDB:O42965	0.887	0.889	8.037E-35	475	0.309	0.309	O42965.pdb.gz	YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.17 PE=4 SV=2
13	PDB:6z3tA	0.724	0.890	1.617E-33	382	0.761	0.948	6z3tA.pdb.gz	Structure of the Inhibited State of the Sec Translocon.
14	AFDB:A0A1D8PDL0	0.843	0.808	2.294E-32	499	0.319	0.305	A0A1D8PDL0.pdb.gz	A0A1D8PDL0_CANAL Ssh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSH1 PE=3 SV=1
15	PDB:6n3qA	0.760	0.919	2.250E-31	391	0.492	0.598	6n3qA.pdb.gz
16	PDB:6nd1B	0.775	0.941	2.655E-30	390	0.494	0.603	6nd1B.pdb.gz
17	PDB:3mp7A	0.703	0.853	9.265E-20	387	0.296	0.364	3mp7A.pdb.gz
18	PDB:2ww9A	0.693	0.676	3.620E-17	490	0.300	0.292	2ww9A.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
19	PDB:5lzrB	0.160	0.128	7.185E-2	697	0.116	0.079	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
20	PDB:4u4tA	0.166	0.174	7.859E-2	444	0.149	0.160	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O80774	0.0	682	475	0.695	0.697	O80774_ARATH AT2G34250 protein OS=Arabidopsis thaliana OX=3702 GN=At2g34250 PE=2 SV=1
2	P32915	0.0	544	480	0.548	0.544	SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC61 PE=1 SV=1
3	P38377	0.0	900	476	0.933	0.933	S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris OX=9615 GN=SEC61A1 PE=1 SV=3
4	P61619	0.0	901	476	0.935	0.935	S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2
5	P61620	0.0	901	476	0.935	0.935	S61A1_MOUSE Protein transport protein Sec61 subunit alpha isoform 1 OS=Mus musculus OX=10090 GN=Sec61a1 PE=1 SV=2
6	P61621	0.0	901	476	0.935	0.935	S61A1_RAT Protein transport protein Sec61 subunit alpha isoform 1 OS=Rattus norvegicus OX=10116 GN=Sec61a1 PE=2 SV=2
7	Q385E6	0.0	540	481	0.546	0.541	Q385E6_TRYB2 Pretranslocation protein, alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4100 PE=3 SV=1
8	Q8RWJ5	0.0	683	475	0.697	0.699	Q8RWJ5_ARATH SecY protein transport family protein OS=Arabidopsis thaliana OX=3702 GN=SEC PE=2 SV=1
9	Q8STG9	0.0	885	476	0.912	0.912	Q8STG9_DROME DSec61alpha OS=Drosophila melanogaster OX=7227 GN=Sec61alpha PE=1 SV=1
10	Q8TC24	0.0	847	418	0.870	0.990	Q8TC24_HUMAN SEC61 translocon subunit alpha 2 OS=Homo sapiens OX=9606 GN=SEC61A2 PE=1 SV=1
11	Q90YL4	0.0	903	476	0.933	0.933	S61A2_DANRE Protein transport protein Sec61 subunit alpha-like 2 OS=Danio rerio OX=7955 GN=sec61al2 PE=2 SV=3
12	Q90ZM2	0.0	909	476	0.945	0.945	S61A1_DANRE Protein transport protein Sec61 subunit alpha-like 1 OS=Danio rerio OX=7955 GN=sec61al1 PE=2 SV=3
13	Q9JLR1	0.0	965	476	1.000	1.000	S61A2_MOUSE Protein transport protein Sec61 subunit alpha isoform 2 OS=Mus musculus OX=10090 GN=Sec61a2 PE=2 SV=3
14	Q9P8E3	0.0	585	479	0.580	0.576	SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC61 PE=3 SV=2
15	Q9ZV90	0.0	685	475	0.693	0.695	Q9ZV90_ARATH F9K20.24 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78720 PE=1 SV=1
16	P79088	2.19e-177	508	479	0.561	0.557	SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec61 PE=2 SV=1
17	Q8U019	1.72e-88	280	468	0.340	0.346	SECY_PYRFU Protein translocase subunit SecY OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=secY PE=1 SV=1
18	O42965	2.59e-83	266	475	0.309	0.309	YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.17 PE=4 SV=2
19	A0A1D8PDL0	7.35e-72	238	499	0.328	0.313	A0A1D8PDL0_CANAL Ssh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSH1 PE=3 SV=1
20	P38353	7.49e-69	229	490	0.305	0.296	SSH1_YEAST Sec sixty-one protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10559 Plug_translocon	1.3e-14	65.0	Plug domain of Sec61p
2	PF00344 SecY	2.9e-73	258.4	SecY

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006150071.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006148967.1	0.998	Protein transport protein Sec61 subunit gamma
2	246437.XP_006161443.1	0.998	Protein transport protein Sec61 subunit beta
3	246437.XP_006172030.1	0.991	Protein transport protein Sec61 subunit beta-like
4	246437.XP_006157021.1	0.988	Translocation protein SEC63 like protein
5	246437.XP_006169325.1	0.966	60S ribosomal protein L9
6	246437.XP_006150366.1	0.957	Translocation protein SEC62
7	246437.XP_006144507.1	0.950	Belongs to the universal ribosomal protein uL22 family.
8	246437.XP_006145207.1	0.942	60S ribosomal protein L11 isoform X1
9	246437.XP_006162513.1	0.938	60S ribosomal protein L8
10	246437.XP_006145252.1	0.931	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit
11	246437.XP_006141067.1	0.928	40S ribosomal protein S3
12	246437.XP_006144167.1	0.925	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 isoform X1
13	246437.XP_006166691.1	0.925	Prominin-2
14	246437.XP_006158307.1	0.918	Belongs to the heat shock protein 70 family.
15	246437.XP_006152362.1	0.916	Hypoxia up-regulated protein 1
16	246437.XP_006150827.1	0.915	Belongs to the universal ribosomal protein uL3 family.
17	246437.XP_006171827.1	0.911	40S ribosomal protein S15
18	246437.XP_006155929.1	0.908	60S ribosomal protein L23
19	246437.XP_006163727.1	0.908	60S ribosomal protein L23-like
20	246437.XP_006153549.1	0.896	60S ribosomal protein L4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0022857	0.766	transmembrane transporter activity
GO:1901363	0.697	heterocyclic compound binding
GO:0097159	0.697	organic cyclic compound binding
GO:0003676	0.681	nucleic acid binding
GO:0003723	0.544	RNA binding
GO:0043021	0.465	ribonucleoprotein complex binding
GO:0043022	0.458	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.950	cellular process
GO:0032502	0.945	developmental process
GO:0032501	0.942	multicellular organismal process
GO:0072001	0.933	renal system development
GO:0048793	0.895	pronephros development
GO:0050896	0.661	response to stimulus
GO:0051179	0.638	localization
GO:0039019	0.597	pronephric nephron development
GO:0070972	0.558	protein localization to endoplasmic reticulum
GO:0065007	0.502	biological regulation
GO:0050789	0.493	regulation of biological process
GO:0006810	0.463	transport
GO:0050794	0.446	regulation of cellular process
GO:0008152	0.361	metabolic process
GO:0045184	0.311	establishment of protein localization
GO:0042221	0.306	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.980	membrane
GO:0031090	0.885	organelle membrane
GO:0032991	0.669	protein-containing complex
GO:0031984	0.608	organelle subcompartment
GO:0042175	0.408	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.399	endoplasmic reticulum membrane
GO:0005791	0.324	rough endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]