StarFunc result for job id Q9H9V9

User Input

>input (463 residues)
MRAGPEPQALAGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRETRALADSHFR
GLGVDVPGVGQAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTP
AGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCL
YLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDALDVDDYRFVYAGPAGSWSPFHADIFR
SFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPALCDTHLHPRNQLAGPPLEIT
QEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRFLQQELCAVQEEVSEWRDS
MPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGR
ITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H9V9	1.000	1.000	3.121E-91	463	1.000	1.000	Q9H9V9.pdb.gz	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
2	AFDB:Q67ZB6	0.748	0.750	1.314E-36	462	0.283	0.284	Q67ZB6.pdb.gz	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
3	AFDB:Q9VJ97	0.706	0.765	1.961E-35	425	0.313	0.341	Q9VJ97.pdb.gz	JMJD4_DROME 2-oxoglutarate and iron-dependent oxygenase JMJD4 homolog OS=Drosophila melanogaster OX=7227 GN=CG7200 PE=2 SV=1
4	AFDB:O13977	0.689	0.688	7.618E-25	464	0.212	0.211	O13977.pdb.gz	JMJ1_SCHPO JmjC domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj1 PE=4 SV=1
5	AFDB:Q386X8	0.524	0.537	2.715E-20	450	0.210	0.216	Q386X8.pdb.gz	Q386X8_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0004 PE=4 SV=1
6	AFDB:Q386V9	0.452	0.386	2.576E-16	550	0.207	0.175	Q386V9.pdb.gz	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1
7	AFDB:K7EJU9	0.464	0.532	3.211E-16	395	0.210	0.246	K7EJU9.pdb.gz	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
8	AFDB:Q67XX3	0.444	0.411	4.231E-16	502	0.173	0.159	Q67XX3.pdb.gz	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
9	AFDB:Q9GYI4	0.436	0.499	1.207E-15	400	0.158	0.182	Q9GYI4.pdb.gz	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
10	AFDB:Q6NYC1	0.435	0.494	1.348E-15	403	0.177	0.203	Q6NYC1.pdb.gz	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
11	PDB:5nfnB	0.436	0.619	9.373E-14	318	0.132	0.192	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
12	PDB:4qszA	0.434	0.300	1.235E-13	686	0.143	0.096	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
13	PDB:7yxgA	0.413	0.592	1.585E-11	313	0.145	0.214	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
14	PDB:3al5C	0.408	0.634	1.220E-10	284	0.108	0.176	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
15	PDB:4b7eA	0.378	0.487	1.795E-10	349	0.117	0.155	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
16	PDB:3al5B	0.447	0.637	3.480E-10	311	0.114	0.170	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
17	PDB:4bxfA	0.324	0.348	2.758E-7	425	0.112	0.122	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:4cclB	0.307	0.371	5.059E-7	372	0.080	0.099	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4bu2A	0.203	0.242	2.123E-6	379	0.078	0.095	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:2fdjA	0.169	0.327	3.793E-4	207	0.054	0.121	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H9V9	0.0	956	463	1.000	1.000	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
2	Q9VJ97	3.91e-74	241	425	0.300	0.327	JMJD4_DROME 2-oxoglutarate and iron-dependent oxygenase JMJD4 homolog OS=Drosophila melanogaster OX=7227 GN=CG7200 PE=2 SV=1
3	Q67ZB6	3.47e-71	234	462	0.270	0.271	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
4	O13977	1.56e-28	119	464	0.166	0.166	JMJ1_SCHPO JmjC domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj1 PE=4 SV=1
5	Q67XX3	1.00e-21	100	502	0.175	0.161	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
6	Q386X8	1.38e-21	99.0	450	0.171	0.176	Q386X8_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0004 PE=4 SV=1
7	B2WTI4	1.30e-18	89.4	361	0.175	0.224	B2WTI4_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
8	K7EJU9	1.37e-18	89.7	395	0.175	0.205	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
9	Q386V9	2.37e-18	89.7	550	0.130	0.109	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1
10	Q6NYC1	3.05e-18	88.6	403	0.179	0.206	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
11	Q9ERI5	1.01e-17	87.0	403	0.173	0.199	JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus OX=10090 GN=Jmjd6 PE=1 SV=2
12	Q9VD28	6.15e-17	84.7	408	0.160	0.181	JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster OX=7227 GN=PSR PE=2 SV=1
13	Q6PFM0	6.46e-17	84.7	403	0.175	0.201	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
14	Q6Q4H1	5.48e-13	72.4	385	0.143	0.171	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1
15	Q9GYI4	6.03e-13	72.4	400	0.143	0.165	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
16	Q27GT3	1.36e-10	64.3	284	0.099	0.162	Q27GT3_CAEEL JmjC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=1
17	Q8RWR1	2.49e-08	58.2	429	0.149	0.161	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
18	A0A0S2Z5T1	1.49e-06	52.8	416	0.127	0.142	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
19	Q8N371	1.49e-06	52.8	416	0.127	0.142	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
20	Q96S16	3.73e-06	50.4	264	0.082	0.144	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	5.3e-13	60.9	Cupin-like domain
2	PF02373 JmjC	3.8e-15	67.7	JmjC domain, hydroxylase
3	PF08007 JmjC_2	79	14.2	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355720

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216489	0.955	Nucleic acid dioxygenase ALKBH1
2	9606.ENSP00000292566	0.903	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4
3	9606.ENSP00000368152	0.903	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
4	9606.ENSP00000245812	0.902	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial
5	9606.ENSP00000382091	0.902	RNA demethylase ALKBH5
6	9606.ENSP00000380467	0.826	JmjC domain-containing protein 7
7	9606.ENSP00000398181	0.814	DNA oxidative demethylase ALKBH2
8	9606.ENSP00000380692	0.759	Lysine-specific demethylase 7A
9	9606.ENSP00000346627	0.754	tRNA wybutosine-synthesizing protein 5
10	9606.ENSP00000302562	0.753	HSPB1-associated protein 1
11	9606.ENSP00000313670	0.715	ALS2 C-terminal-like protein
12	9606.ENSP00000328251	0.681	Ribosomal oxygenase 2
13	9606.ENSP00000477507	0.681	Ribosomal oxygenase 1
14	9606.ENSP00000358925	0.657	Proline/serine-rich coiled-coil protein 1
15	9606.ENSP00000314157	0.640	Synaptosomal-associated protein 47
16	9606.ENSP00000457258	0.621	Prolyl 3-hydroxylase OGFOD1
17	9606.ENSP00000324775	0.617	Transmembrane inner ear expressed protein
18	9606.ENSP00000302232	0.612	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
19	9606.ENSP00000352185	0.607	Lysine-specific demethylase PHF2
20	9606.ENSP00000272322	0.604	Vacuolar protein sorting-associated protein 54

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016706	0.999	2-oxoglutarate-dependent dioxygenase activity
GO:0140096	0.932	catalytic activity, acting on a protein
GO:0032451	0.932	demethylase activity
GO:0032452	0.906	histone demethylase activity
GO:0003676	0.672	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0018126	0.996	protein hydroxylation
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0010556	0.988	regulation of macromolecule biosynthetic process
GO:0031326	0.988	regulation of cellular biosynthetic process
GO:0051173	0.984	positive regulation of nitrogen compound metabolic process
GO:0010557	0.982	positive regulation of macromolecule biosynthetic process
GO:0031328	0.981	positive regulation of cellular biosynthetic process
GO:0010628	0.975	positive regulation of gene expression
GO:0043244	0.953	regulation of protein-containing complex disassembly
GO:0045727	0.931	positive regulation of translation
GO:0043243	0.928	positive regulation of protein-containing complex disassembly
GO:0009987	0.695	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.969	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.999	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]