StarFunc result for job id Q9H9Y6

User Input

>input (1135 residues)
MDPGSRWRNLPSGPSLKHLTDPSYGIPREQQKAALQELTRAHVESFNYAVHEGLGLAVQA
IPPFEFAFKDERISFTILDAVISPPTVPKGTICKEANVYPAECRGRRSTYRGKLTADINW
AVNGISKGIIKQFLGYVPIMVKSKLCNLRNLPPQALIEHHEEAEEMGGYFIINGIEKVIR
MLIMPRRNFPIAMIRPKWKTRGPGYTQYGVSMHCVREEHSAVNMNLHYLENGTVMLNFIY
RKELFFLPLGFALKALVSFSDYQIFQELIKGKEDDSFLRNSVSQMLRIVMEEGCSTQKQV
LNYLGECFRVKLNVPDWYPNEQAAEFLFNQCICIHLKSNTEKFYMLCLMTRKLFALAKGE
CMEDNPDSLVNQEVLTPGQLFLMFLKEKLEGWLVSIKIAFDKKAQKTSVSMNTDNLMRIF
TMGIDLTKPFEYLFATGNLRSKTGLGLLQDSGLCVVADKLNFIRYLSHFRCVHRGADFAK
MRTTTVRRLLPESWGFLCPVHTPDGEPCGLMNHLTAVCEVVTQFVYTASIPALLCNLGVT
PIDGAPHRSYSECYPVLLDGVMVGWVDKDLAPGIADSLRHFKVLREKRIPPWMEVVLIPM
TGKPSLYPGLFLFTTPCRLVRPVQNLALGKEELIGTMEQIFMNVAIFEDEVFAGVTTHQE
LFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQSP
LVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFID
LSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMY
YKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAE
DMPFTESGMVPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALE
YFGEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDR
VTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVKCGSLLSPL
LEKPPPSWSAMRNRKYNCTLCSRSDTIDTVSVPYVFRYFVAELAAMNIKVKLDVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5lmxB	0.890	0.906	0.000	1115	0.415	0.422	5lmxB.pdb.gz	The dynamic assembly of distinct RNA polymerase I complexes modulates rDNA transcription.
2	PDB:5m5wB	0.935	0.898	0.000	1183	0.440	0.422	5m5wB.pdb.gz	Molecular Structures of Transcribing RNA Polymerase I.
3	PDB:8a43B	0.957	0.960	0.000	1131	0.996	1.000	8a43B.pdb.gz
4	AFDB:B8JKD7	0.992	0.995	0.000	1132	0.755	0.757	B8JKD7.pdb.gz	RPA2_DANRE DNA-directed RNA polymerase I subunit RPA2 OS=Danio rerio OX=7955 GN=polr1b PE=3 SV=1
5	AFDB:F4I366	0.926	0.893	0.000	1178	0.423	0.407	F4I366.pdb.gz	NRPA2_ARATH DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPA2 PE=2 SV=1
6	AFDB:P20028	0.972	0.977	0.000	1129	0.444	0.446	P20028.pdb.gz	RPA2_DROME DNA-directed RNA polymerase I subunit RPA2 OS=Drosophila melanogaster OX=7227 GN=RpI135 PE=1 SV=2
7	AFDB:P22138	0.954	0.900	0.000	1203	0.441	0.416	P22138.pdb.gz	RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPA135 PE=1 SV=1
8	AFDB:P70700	0.999	0.999	0.000	1135	0.903	0.903	P70700.pdb.gz	RPA2_MOUSE DNA-directed RNA polymerase I subunit RPA2 OS=Mus musculus OX=10090 GN=Polr1b PE=1 SV=2
9	AFDB:Q27493	0.935	0.942	0.000	1127	0.446	0.449	Q27493.pdb.gz	RPA2_CAEEL DNA-directed RNA polymerase I subunit RPA2 homolog OS=Caenorhabditis elegans OX=6239 GN=rpoa-2 PE=3 SV=1
10	AFDB:Q387I8	0.868	0.624	1.733E-94	1596	0.315	0.224	Q387I8.pdb.gz	Q387I8_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0450 PE=3 SV=1
11	AFDB:P22276	0.820	0.810	9.523E-91	1149	0.293	0.289	P22276.pdb.gz	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
12	AFDB:Q10233	0.823	0.802	2.132E-90	1165	0.284	0.276	Q10233.pdb.gz	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1
13	AFDB:P38420	0.819	0.784	2.357E-90	1188	0.290	0.277	P38420.pdb.gz	NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPB2 PE=1 SV=2
14	PDB:7ok0B	0.823	0.841	2.264E-88	1109	0.278	0.285	7ok0B.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	PDB:7o4iB	0.806	0.777	2.361E-85	1180	0.288	0.277	7o4iB.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:4aybB	0.817	0.839	7.150E-85	1103	0.271	0.279	4aybB.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
17	PDB:6o6cB	0.811	0.791	5.314E-81	1165	0.283	0.276	6o6cB.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
18	PDB:7d58B	0.781	0.808	1.076E-80	1095	0.290	0.300	7d58B.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
19	PDB:4bxxB	0.784	0.809	1.780E-80	1097	0.285	0.294	4bxxB.pdb.gz	Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
20	PDB:5iy6B	0.816	0.796	1.925E-78	1165	0.287	0.280	5iy6B.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JKD7	0.0	1843	1132	0.755	0.757	RPA2_DANRE DNA-directed RNA polymerase I subunit RPA2 OS=Danio rerio OX=7955 GN=polr1b PE=3 SV=1
2	F4I366	0.0	863	1178	0.430	0.414	NRPA2_ARATH DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPA2 PE=2 SV=1
3	O54888	0.0	1095	1135	0.454	0.454	RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus OX=10116 GN=Polr1b PE=1 SV=1
4	P20028	0.0	1012	1129	0.448	0.451	RPA2_DROME DNA-directed RNA polymerase I subunit RPA2 OS=Drosophila melanogaster OX=7227 GN=RpI135 PE=1 SV=2
5	P22138	0.0	952	1203	0.448	0.423	RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPA135 PE=1 SV=1
6	P70700	0.0	2186	1135	0.903	0.903	RPA2_MOUSE DNA-directed RNA polymerase I subunit RPA2 OS=Mus musculus OX=10090 GN=Polr1b PE=1 SV=2
7	Q27493	0.0	1018	1127	0.449	0.453	RPA2_CAEEL DNA-directed RNA polymerase I subunit RPA2 homolog OS=Caenorhabditis elegans OX=6239 GN=rpoa-2 PE=3 SV=1
8	Q9H9Y6	0.0	2371	1135	1.000	1.000	RPA2_HUMAN DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B PE=1 SV=2
9	H7C0D9	5.36e-142	432	307	0.181	0.668	H7C0D9_HUMAN DNA-directed RNA polymerase I subunit RPA2 (Fragment) OS=Homo sapiens OX=9606 GN=POLR1B PE=1 SV=8
10	P22276	8.94e-135	440	1149	0.306	0.302	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
11	F1QQA2	1.30e-128	423	1130	0.312	0.313	F1QQA2_DANRE DNA-directed RNA polymerase subunit beta OS=Danio rerio OX=7955 GN=polr3b PE=1 SV=2
12	Q9NW08	6.76e-128	421	1133	0.307	0.308	RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B PE=1 SV=2
13	Q10233	5.81e-127	419	1165	0.319	0.311	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1
14	F4KD38	1.12e-125	416	1161	0.306	0.299	NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPC2 PE=2 SV=1
15	Q4GZE8	1.39e-125	415	1129	0.302	0.304	Q4GZE8_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.540 PE=3 SV=1
16	P11513	4.78e-125	413	1126	0.299	0.301	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
17	Q8T307	5.83e-120	407	1596	0.256	0.182	Q8T307_TRYBB DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei OX=5702 GN=RPA2 PE=2 SV=1
18	C9J4M6	8.78e-120	397	1067	0.290	0.308	C9J4M6_HUMAN DNA-directed RNA polymerase subunit beta OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=3
19	Q387I8	1.14e-119	407	1596	0.255	0.181	Q387I8_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0450 PE=3 SV=1
20	Q8CFI7	1.29e-119	399	1174	0.300	0.290	RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus OX=10090 GN=Polr2b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06685 DUF1186	1.5e+02	13.2	Protein of unknown function (DUF1186)
2	PF06883 RNA_pol_Rpa2_4	4.9e-16	69.7	RNA polymerase I, Rpa2 specific domain
3	PF04563 RNA_pol_Rpb2_1	5.1e-31	119.3	RNA polymerase beta subunit
4	PF04561 RNA_pol_Rpb2_2	2.8e-09	48.4	RNA polymerase Rpb2, domain 2
5	PF04565 RNA_pol_Rpb2_3	8e-25	98.1	RNA polymerase Rpb2, domain 3
6	PF00562 RNA_pol_Rpb2_6	4.2e-115	396.5	RNA polymerase Rpb2, domain 6
7	PF04560 RNA_pol_Rpb2_7	8.9e-19	79.0	RNA polymerase Rpb2, domain 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222567	0.999	DNA-directed RNA polymerase I subunit RPA43
2	9606.ENSP00000263857	0.999	DNA-directed RNA polymerase I subunit RPA1
3	9606.ENSP00000302478	0.999	DNA-directed RNA polymerases I and III subunit RPAC2
4	9606.ENSP00000324124	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC5
5	9606.ENSP00000331111	0.999	DNA-directed RNA polymerase I subunit RPA12
6	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
7	9606.ENSP00000367029	0.999	DNA-directed RNA polymerase I subunit RPA49
8	9606.ENSP00000478303	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
9	9606.ENSP00000415536	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC3
10	9606.ENSP00000198767	0.997	RNA polymerase I-specific transcription initiation factor RRN3
11	9606.ENSP00000403852	0.989	DNA-directed RNA polymerases I, II, and III subunit RPABC2
12	9606.ENSP00000342889	0.988	DNA-directed RNA polymerases I, II, and III subunit RPABC4
13	9606.ENSP00000361446	0.987	DNA-directed RNA polymerase III subunit RPC1
14	9606.ENSP00000423067	0.983	WD repeat-containing protein 36
15	9606.ENSP00000454836	0.982	Transducin beta-like protein 3
16	9606.ENSP00000263239	0.980	ATP-dependent RNA helicase DDX18
17	9606.ENSP00000301364	0.964	Pre-rRNA-processing protein TSR1 homolog
18	9606.ENSP00000334564	0.964	DNA-directed RNA polymerase III subunit RPC3
19	9606.ENSP00000228347	0.962	DNA-directed RNA polymerase III subunit RPC2
20	9606.ENSP00000370968	0.962	Myb-binding protein 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.955	catalytic activity
GO:0140640	0.935	catalytic activity, acting on a nucleic acid
GO:0003899	0.927	DNA-directed 5'-3' RNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034660	0.995	ncRNA metabolic process
GO:0010467	0.971	gene expression
GO:0034654	0.924	nucleobase-containing compound biosynthetic process
GO:0009059	0.918	macromolecule biosynthetic process
GO:0006351	0.911	DNA-templated transcription
GO:0016072	0.839	rRNA metabolic process
GO:0098781	0.704	ncRNA transcription
GO:0032501	0.692	multicellular organismal process
GO:0032502	0.683	developmental process
GO:0048856	0.628	anatomical structure development
GO:0009303	0.605	rRNA transcription
GO:0071840	0.528	cellular component organization or biogenesis
GO:0050789	0.469	regulation of biological process
GO:0007275	0.414	multicellular organism development
GO:0050794	0.305	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0032991	0.991	protein-containing complex
GO:0005829	0.985	cytosol
GO:1902494	0.901	catalytic complex
GO:0140513	0.873	nuclear protein-containing complex
GO:0140535	0.848	intracellular protein-containing complex
GO:1990234	0.840	transferase complex
GO:0055029	0.805	nuclear DNA-directed RNA polymerase complex
GO:0005736	0.474	RNA polymerase I complex
GO:0005694	0.346	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.927	DNA-directed RNA polymerase.

[back to server]